KEGG   Sinocyclocheilus rhinocerous: 107743863Help
Entry
107743863         CDS       T04916                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK2-like
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107743863
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:srx01001]
    107743863
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:srx03036]
    107743863
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     107743863
Protein kinases [BR:srx01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   107743863
Chromosome and associated proteins [BR:srx03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107743863
   Centrosome duplication proteins
    Regulators of centriole replication
     107743863
  Sister chromatid separation proteins
   Polo kinases
    107743863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like PilN_bio_d
Motif
Other DBs
NCBI-GeneID: 107743863
NCBI-ProteinID: XP_016412798
Position
Unknown
AA seq 658 aa AA seqDB search
METLRNTSYPTITTHNDKMCELNKISEQGWKKPDDNSRTGTEYSRIITDPNTGKCYCRGK
VLGKGGFAKCYEMTDLSSSKVYAAKIIPHSRVSKPYQREKINREIDLQRALSHKHIVHFY
HHFEDKDNIYILLEYCSRRSLAHILKARKVLTEPEVRYYLKQTVSALKYLHDLEILHRDL
KLGNLFVNDSMELKVGDFGLAAKLEPVSNRRKTICGTPNYLSPEVLNKQGHGWESDVWAL
GCVMYTMLLGKPPFETTNLKETYRCIREARYTIPASLSLPAKQLISGMLAQNPVDRPHLD
DIIRHEFFIQGFMPETLPVSCCHSAPDFHISSPAKSFFKKAAAALFGGKKDKAKYYENIN
RLAKEEEDIFKLHQDFRKTAISNQITTHSSEEGGNPSAPTRTPVTQATAGRPQTRDTIHL
IVRGSLGSCSSSSECLEDSTTGTVAEAVISVLRGCLEHMPKGDGLPRGSGCNILKWVTKW
VDYSNKYGFGYQLSDNTVGVLFNNGTHMSLLSDKKTVHQYAALGQRSVFSVIEAPEYAVA
QVTILKYFAHYMEENLMDGGDMISEPDTQKTRIYLLQWLKSDRALLMLFNDGTFQVNFYH
DHTKLILCTQQDEYLLTYINEERTSTTFQLSTLLSAGCTADLRSRLEYASNMLLQRCN
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggagacactgaggaatacctcgtacccaactataacgacacacaacgacaagatgtgt
gagctcaataaaataagtgagcaaggatggaaaaagccagatgataacagtcggaccggc
acagagtattccagaatcattacagaccccaacactgggaaatgttactgccggggaaaa
gttctaggaaagggaggctttgctaagtgctatgaaatgaccgacctgtcttcaagtaaa
gtctatgcagccaaaatcatcccgcattcgcgtgtgtcaaaaccttaccagagagagaag
ataaaccgagagattgacctccaaagagctctcagccacaaacacatagtgcatttctac
caccactttgaagacaaagacaacatctatattctgttggagtactgcagtagaagatca
ctggcccatatattgaaggcacgtaaagtcctaacagaacctgaagtgaggtattacttg
aaacagacagtgtctgctttaaaataccttcacgatttagagatcctgcatcgtgacttg
aaactaggcaacttgtttgtgaatgactcaatggagctgaaagtgggagattttgggctg
gctgccaaactggagccagtcagcaacagacgcaaaacgatctgcggtacacccaactac
ctgtccccggaagtgctgaacaaacagggccacggctgggagtctgatgtgtgggctttg
ggctgcgtcatgtacaccatgctgttgggtaaacctccatttgagaccactaaccttaag
gagacgtaccgctgtatccgagaggcccgttacactatcccggcctcgctctctctcccc
gccaaacagctaatttccggcatgctcgcacagaaccctgtggaccgcccgcacctggat
gacatcattcggcatgaattttttatccagggcttcatgccagaaactctgcctgtcagc
tgctgccattctgccccagacttccatatttccagtccagccaagagcttcttcaaaaaa
gcagccgctgctctcttcggtggcaagaaggacaaagccaagtactatgaaaatataaat
cgcttagccaaagaagaggaagatatattcaagctccatcaagatttcagaaagactgcc
atcagtaatcagattactacacactcatccgaggaaggaggaaatccatcagcacctaca
agaacgcctgttacccaggcaactgctggaaggccacagacaagagataccattcacttg
attgttagaggcagcttgggcagctgcagcagcagcagtgaatgtcttgaagacagcacc
actggcactgtggcagaggctgttattagtgttctgagaggctgtcttgaacacatgcct
aaaggggacggccttcccagaggaagtggttgtaatatattgaagtgggtgactaagtgg
gttgactactccaacaaatatggctttggctatcagttgtctgacaacaccgtgggcgtc
cttttcaacaacggaacacacatgagtctcctctctgacaagaagactgttcatcagtat
gctgccctcggtcagaggtctgttttttctgttattgaggctcctgagtatgctgtggcc
caggtcaccatcctcaagtactttgcccactacatggaggagaatttgatggatggaggg
gatatgataagtgaaccagatacccagaagaccagaatatatcttctgcagtggctgaaa
tcagacagagctttattgatgcttttcaacgatggcacattccaggtgaacttctaccac
gaccacaccaagctcatcctgtgcacacagcaagacgaatatctgctgacgtacatcaat
gaggagcgaacctccaccactttccaactgagcactttgctcagtgcgggctgcactgcg
gacctgcggagtcgtctggagtatgcctcgaacatgctgctgcagagatgcaactga

DBGET integrated database retrieval system