KEGG   Sinocyclocheilus rhinocerous: 107746117
Entry
107746117         CDS       T04916                                 

Definition
(RefSeq) uncharacterized protein LOC107746117
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107746117
Enzymes [BR:srx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     107746117
SSDB
Motif
Pfam: AstE_AspA Coa1 RRM_1
Other DBs
NCBI-GeneID: 107746117
NCBI-ProteinID: XP_016415698
Position
Unknown
AA seq 260 aa
MCGASWPVEVRAAVTSAASCVKDDPVLLTEAGREERDGIGIPGQQAVKECRRYIDKDMNR
CFNRAMLSSPITDSSPYEVRRAQELNNLLGPKGSTDAMDLICDLHNTTANMGLTLIHYTT
SDWVTLHICKYLQTKITKVPVRVLVLDVPISEETVKPLSPITDSSPYEVRRAQELNNLLG
PKGSTDAINLICDLHNTTANMGLTLIHYTTSDWVTLHICKYLQTKITKVPVRVLVLDVPI
SEETVKPLYDCLWWMSYHIL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtgtggagcttcatggccagtggaagtgagagctgctgtgacatcagcagcatcatgt
gtgaaagatgatccagtgctgctgactgaggcaggcagagaagaacgagatggcattggc
attccggggcagcaggctgtgaaagagtgcagaagatacattgacaaggatatgaaccgc
tgcttcaacagggccatgctgagttctcctattacagacagcagcccgtatgaagtccgg
cgcgctcaggaactgaacaatctgctggggccgaaaggatccacagatgcaatggacttg
atctgtgaccttcataacaccacggctaacatgggcctcacactgatccattacacgacc
agtgactgggtgactctgcacatctgcaaatacttacagactaagataaccaaagtgcct
gtgagagtgctggtactggatgtcccgattagtgaagaaactgtgaagccactttctcct
attacagacagcagcccgtatgaagtccggcgcgctcaggaactgaacaatctgctgggg
ccgaaaggatccacagatgcaatcaacttgatctgtgaccttcataacaccacggctaac
atgggcctcacactgatccattacacgaccagtgactgggtgactctgcacatctgcaaa
tacttacagactaagataaccaaagtgcctgtgagagtgctggtactggatgtcccgatt
agtgaagaaactgtgaagccactgtatgattgtctttggtggatgtcctatcatatactc
taa

DBGET integrated database retrieval system