KEGG   Sinocyclocheilus rhinocerous: 107746831Help
Entry
107746831         CDS       T04916                                 

Definition
(RefSeq) T-box transcription factor TBX6L-like
  KO
K10180  T-box protein 6
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107746831
   03019 Messenger RNA biogenesis [BR:srx03019]
    107746831
Transcription factors [BR:srx03000]
 Eukaryotic type
  Other transcription factors
   T-box
    107746831
Messenger RNA biogenesis [BR:srx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107746831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 107746831
NCBI-ProteinID: XP_016416638
Position
Unknown
AA seq 546 aa AA seqDB search
MVMYLPEERPVLDLPYQMNYLANNYGYYPQDCKEPIFRTQHGLNSRMNSPEAELTSLPVH
VSLQDRELWDKFSSMGTEMLITKSGRRMFPSCKVTVTGLNPKVKYVVIMDMVPFDNHKYK
WNKDRWEVNGSTDPHLPNRFFIHPDSPAPGEKWMQYPISFHKLKLTNNTLNSNGLVVVHS
MHKYQPRLHIVQSPDPCNPHNSGGYLRFTFPEAAFKAVTAYQNQEITKLKIDNNPFAKGF
RDNGLNRKRFREKESQETPDSVGQAKQDLTSNDHVGQPQKDEEVDVTVSSSVDCRRTLNS
SEVASSVTPNPFISAFINPSTAGGPSPHQTHTILSLSNRHLNSPREARPSSLHSLCAALP
VAQSFCVQSSTGDTNLSSPLNPQQHHHHCSPASQTPGRSIIQLQPYFQTPPHPSRQCPDM
ELPLPLPPKLSRMQLPESALRNLEMTPGSDYANLRPLTDILNRIHFRALASGPSGKVLQN
PPQPEQYLRGSDRELRPQIYPALQEYIDQQFTLNSMLSSQTEHRSQMDYVSARPQTEYYC
EQQPGK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgtatctcccagaggaacggcctgtgctggacttaccttaccaaatgaattat
ttggctaataattatggatattatccacaagactgtaaggaacccattttccgcactcaa
catggcctcaatagcaggatgaacagtcctgaagctgaactgacctcactgccagtgcat
gtatccctgcaagatcgagagctttgggacaaattcagcagtatgggcacagagatgctg
attactaaatctggaaggcggatgtttcccagctgcaaagtaacagtgacgggactaaat
ccaaaagtcaagtatgtggtgataatggacatggtgccttttgataaccacaagtacaag
tggaataaggaccgttgggaagtgaatggttcaactgatccacacctgcccaatcggttc
ttcatccatccagactctcctgcacctggagagaaatggatgcagtatccaatctccttt
cacaagctcaaactgaccaacaacaccctcaactctaatggcctggtggttgtccactcc
atgcacaaataccagccccgtctacacattgtccaatctccagacccctgtaaccctcac
aactctggcggttacctgcgcttcaccttccctgaagctgcttttaaagctgtcacagcc
taccagaaccaagagatcacaaaactcaagattgacaacaacccctttgctaaaggcttt
cgtgacaatgggctgaacaggaaaaggtttagagaaaaagagagccaagagaccccggat
tccgttggacaggccaaacaggatctgacatcaaatgaccatgtaggacagccacagaag
gatgaggaagtggatgtgaccgtgtccagctctgttgactgcagaagaacactgaattct
tcagaagtggcttcctcggtcacccccaaccctttcatatcagccttcataaaccccagc
actgctggaggaccttcaccccatcagacacacaccattctcagcctcagtaacagacac
ctgaacagtcccagagaagccagaccctccagcctccatagtctgtgtgcagctttgccc
gtggcccagagcttctgtgtccagtcctccacaggagacaccaacctcagcagccctcta
aaccctcagcagcaccatcaccactgcagcccagcttctcaaaccccaggcagatccatc
atccagctccagccttattttcagacccctccacatccctcacgacaatgtcctgacatg
gagctgcccctccctctgcctcccaaactgagccggatgcaactccctgaaagtgctctg
aggaacctggagatgaccccaggctctgactatgctaatctgaggcccctcactgacatc
ctcaacaggatccattttcgagctttagcctcaggaccatcggggaaggtcctgcaaaat
cccccccaacctgagcagtacctccgtggctcagaccgagagctgcgtccgcagatttat
ccagcgctgcaggaatacatcgatcagcagttcacattaaacagcatgctgagcagccag
actgaacacagatcacagatggactatgtcagtgccagaccacaaactgaatattactgt
gaacagcagcctgggaaatga

DBGET integrated database retrieval system