KEGG   Sinocyclocheilus rhinocerous: 107747002Help
Entry
107747002         CDS       T04916                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx03040  Spliceosome
srx04010  MAPK signaling pathway
srx04141  Protein processing in endoplasmic reticulum
srx04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:srx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107747002
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107747002
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107747002
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107747002
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107747002
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:srx03041]
    107747002
   03009 Ribosome biogenesis [BR:srx03009]
    107747002
   03110 Chaperones and folding catalysts [BR:srx03110]
    107747002
   04131 Membrane trafficking [BR:srx04131]
    107747002
   03051 Proteasome [BR:srx03051]
    107747002
   03029 Mitochondrial biogenesis [BR:srx03029]
    107747002
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:srx04147]
    107747002
Protein phosphatases and associated proteins [BR:srx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107747002
Spliceosome [BR:srx03041]
 Complex B
  Other components
   Prp19 complex
    107747002
 Complex C
   Prp19-CDC5 complex
    107747002
Ribosome biogenesis [BR:srx03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107747002
Chaperones and folding catalysts [BR:srx03110]
 Heat shock proteins
  HSP70 / DNAK
   107747002
Membrane trafficking [BR:srx04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107747002
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107747002
Proteasome [BR:srx03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107747002
Mitochondrial biogenesis [BR:srx03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107747002
Exosome [BR:srx04147]
 Exosomal proteins
  Proteins found in most exosomes
   107747002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG DDR MetOD2
Motif
Other DBs
NCBI-GeneID: 107747002
NCBI-ProteinID: XP_016416871
Position
Unknown
AA seq 649 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEIS
SMVLTKMKEIAEAYLGKTVSNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKVEDDVQRDKVSSKN
GLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPDGMPGGFPGAGAAPGGGSSGPTIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggaccagctgttggtattgatctcgggaccacctactcctgtgtaggtgtt
ttccaacatggaaaagttgaaatcattgctaatgaccaaggaaacaggaccactccaagc
tatgtagctttcacagatagtgagagattgattggagatgctgcaaaaaaccaggtcgcc
atgaaccccaccaacacagtctttgatgccaagcgtctgattggtcgcaggtttgatgat
ggcgttgttcagtctgatatgaagcactggccttttaatgtcatcaatgacaatacccgt
cccaaggtccaggttgaatacaagggtgagaccaagtctttctaccctgaagagatttcc
tccatggttctcaccaagatgaaggaaatcgctgaggcctacctgggaaagacggtttcc
aacgctgtcgtcacagtgcctgcctacttcaacgattctcagcgacaggccaccaaggat
gctggaaccatctctggattgaatgttctgcgtataatcaatgaaccaactgctgctgct
attgcttacggtctggacaaaaaggttggtgctgagaggaatgtcctcatcttcgatctt
ggtggtggcactttcgatgtgtctatcctcaccattgaggatggcatcttcgaggtaaaa
tctactgctggagacactcacttgggtggagaagactttgacaaccgcatggtgaaccac
ttcatcacagagttcaagcgcaagcacaagaaggacatcagcgacaacaagagagccgtt
cgccgtctccgcactgcctgcgagagggccaagcgtaccctgtcctccagcactcaggcc
agtattgagatcgactccctctatgagggtatcgatttctatacctccatcaccagggct
cgttttgaggagctcaacgctgacctcttccgtggcacattggacccagtcgagaagtca
cttcgtgacgccaagatggacaaggctcagatccacgacattgtcctggttggtggctcc
actcgcattcctaaaatccagaagctgctccaagactacttcaacggcaaggagcttaat
aagagcatcaaccccgatgaggctgtggcctatggagcagccgttcaggctgccatcctc
tctggtgacaagtctgagaatgttcaggacttgctgctgctagatgtcactcctctgtcc
cttggaattgagacagctggtggagtcatgactgtcctcatcaagcgtaataccactatc
ccaaccaaacagactcagactttcaccacctattctgacaaccagccaggtgtgctcatt
caggtctatgagggtgagcgtgcaatgaccaaggataacaacttgctgggcaagtttgag
cttactggaatcccccctgcacctcgtggtgttccccagattgaggtcacctttgacatt
gatgccaatggcatcatgaatgtttcagctgttgataagagcactggcaaggagaacaaa
atcaccatcaccaacgataagggtcgtctcagcaaggaggacattgagcgcatggtgcag
gaggcagagaagtacaaggttgaggatgatgtgcagcgcgacaaggtgtcttccaagaat
ggtctggaatcatatgccttcaacatgaagtccactgttgaggatgagaaactaaagggc
aagatcagtgatgaggacaagcagaagatccttgacaagtgcaatgaagtcattagttgg
cttgacaagaaccagactgctgagaaggaagagtttgagcaccagcagaaggagctggag
aaggtatgcaaccccatcatcaccaagctgtaccagagtgctggaggcatgccaggtgga
atgcctgatggtatgcctggtggcttcccgggagctggcgccgctccaggaggtggatcc
tccggcccaaccattgaggaggtcgactaa

DBGET integrated database retrieval system