KEGG   Sinocyclocheilus rhinocerous: 107749051Help
Entry
107749051         CDS       T04916                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107749051
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     107749051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 107749051
NCBI-ProteinID: XP_016419587
Position
Unknown
AA seq 670 aa AA seqDB search
MADTRADPAAQSELMVEDEPFFSYLDLFLFSLIAGLLVYWIIFRKKAEPIPEFKKLESTP
QTTRETSFIGKMKKTGKNIVVFYGSQTGTGEEFANRLAKDAHRYGMKGMAADPEEYDMSE
LSRLTEIENSIAIFCLATYGEGDPTDNAQDFYDWLQEGDADFSGVKYTVFALGNKTYEHY
NAMGKYVDKRLAELGAQRIFDLGMGDDDGNLEEDFVSWREQFWPAVCEHFGVEATGEESS
IRQYELKVHSDLNMNKIYTGELGRLMSFENQKPPFDSKNPFLAAVTVNRKLNKAGDRHLM
HLELDITGSKIRYESGDHVAVYPINDSVIVNRIGDLLGVDLDMVISLNNLDEESNKKHPF
PCPSTYRTALTHYLDITNPPRTNVLYELAQYATEPKDQENMRKMASSSPEGKALYQSWVL
DSCRNILAILEDLPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVVVEYETK
TGRVNKGVATNWLKNKMPTDNGHKTTVPMYIRKSQFRLPFKSTNPVIMVGPGTGIAPFMG
FVQERGWLKEQGKDVGDTVLYYGCRYKNEDFLYQEDLEEFEKTGVLTALNVAFSRDQAEK
VYVQHLLKKNKEAVWRLVHSDNAHIYICGDARNMARDVQNAFYEIAEELGGMSRAQAGDX
KGRYSQDVWS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacacgggccgatcccgccgcgcagtcggagctgatggttgaggacgagccc
ttcttcagttacctggacctcttcctcttctcgctcatcgctggcctgctcgtctactgg
atcattttccgcaaaaaagccgagcccatcccggagttcaaaaaactagagtctacgcct
caaacaaccagagaaaccagttttattggcaagatgaagaaaacgggcaagaacatcgtg
gtgttttacggctcacagacgggcacgggtgaagagtttgccaacagacttgcaaaagat
gctcatcgctacggcatgaagggaatggcagcagatccagaggaatatgacatgagtgag
ctctcccgtctgactgagattgagaactcgatagcgatcttctgcttggccacgtatgga
gagggagacccgaccgataacgctcaggacttctatgactggttacaggagggcgatgcc
gacttcagtggagttaaatatacagtgtttgcactgggaaataagacatacgagcactat
aacgccatgggaaagtatgtggacaagagactggctgagctgggagcccagcggatcttt
gacctgggaatgggagacgatgacgggaatcttgaggaggacttcgtgtcgtggagagag
cagttctggccggctgtgtgtgaacactttggagtcgaagcgacgggagaagaatccagc
atccgtcagtatgagctgaaggtacacagcgatctgaacatgaataagatctacaccgga
gagctgggtcgcctcatgagcttcgagaaccagaagccgccctttgattcgaagaaccct
ttcctggctgcggtcactgtgaaccgcaagctcaataaggctggagacagacacctgatg
cacctggagctggacatcacaggctccaaaatcaggtatgaatcaggagaccatgtggct
gtgtatcccatcaatgacagcgtcatagtcaaccggatcggtgatctcctcggtgtggac
ctcgacatggtcatctcgctcaacaacctcgacgaggagtccaataagaagcatccgttc
ccctgtcccagcacgtaccgcaccgctctgacgcactatctggacatcaccaatcctccg
cgcacaaacgtgctttatgaactggcgcagtacgccaccgagcccaaagatcaggagaac
atgaggaagatggcctcctcctcgcccgagggcaaagcgctgtaccagagctgggtgctg
gactcgtgcaggaatattttggctattctggaggatttgccgtctctgcggcctcccatc
gatcacctctgtgagctcctgcctcgactgcaggcccgctactactccatcgcatcctcc
tcaaaggttcatcccaacagcatccacatctgtgctgtagtggtggagtacgagaccaag
acaggccgggtcaacaaaggagtcgccactaactggctgaagaacaagatgccaaccgac
aatggacacaagaccacggtgcccatgtacatccgcaagtctcagttccgcctgcccttc
aagtccacaaacccggttatcatggtcggcccgggcactggcatcgcccccttcatgggc
ttcgttcaggagcgcggctggctcaaagaacaaggtaaggacgttggagacacagtgttg
tactatggctgccgttacaagaacgaggacttcctgtaccaagaggatctggaggagttt
gagaagactggggttctgacggcactcaatgtagctttctccagagaccaggccgagaag
gtgtacgtgcagcatctgctgaagaagaacaaggaggccgtctggaggctggttcactcc
gacaacgctcacatctacatctgcggagacgcgcgtaatatggctcgtgacgtccagaac
gccttctacgagatcgccgaggagctgggaggcatgagccgcgcgcaggcgggggatnct
aaaggacgctactcgcaggacgtctggagctaa

DBGET integrated database retrieval system