KEGG   Sinocyclocheilus rhinocerous: 107750283Help
Entry
107750283         CDS       T04916                                 

Definition
(RefSeq) isotocin receptor
  KO
K04229  oxytocin receptor
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04020  Calcium signaling pathway
srx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107750283
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107750283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:srx04030]
    107750283
G protein-coupled receptors [BR:srx04030]
 Rhodopsin family
  Peptide
   Oxytocin
    107750283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx Gaa1
Motif
Other DBs
NCBI-GeneID: 107750283
NCBI-ProteinID: XP_016421085
Position
Unknown
AA seq 314 aa AA seqDB search
MEDIFKDQDLWSFNESSRNSSVHNETYGVNQTVNPLKRNEEVAKVEVTVLALVLFLALAG
NLCVLVAIHTAKHSQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDILCRLVK
YLQTVGMFASTYMLVLMSIDRCMAICQPLRSLHKRKDRCYVICSWALSLLFSIPQVYIFS
LREVGSGVYDCWGDFVQPWGAKAYITWISLTIYIIPVAILSVCYGLISFKIWQNFKRKTK
KDQCITLTPKTSKGSALARVSSVKLISKAKITTVKMTFVIVLAYIVCWTPFFSVQMWSAW
DPEAPREGEFLLKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaggacatcttcaaggatcaagacttatggtccttcaatgagtcgtctagaaactcc
agcgtccacaatgaaacttacggcgtgaaccagacggtgaacccgctgaagcggaacgaa
gaggtggcaaaagtggaagtcactgtattggccttggtgctcttcttggcactcgctggt
aacctctgcgtccttgttgcaatccacacggccaagcacagtcaatctcgcatgtactac
ttcatgaagcacctcagcattgcagatctggtcgtggctgtcttccaggtacttcctcaa
ctcatctgggacatcacgtttcgcttttatggaccagacatcctgtgcaggttggtgaaa
tatcttcagaccgttgggatgttcgcctccacgtacatgctggtgctgatgtccatagac
agatgtatggcaatctgccagccccttcgttctttacacaagcgaaaggaccgctgttac
gtgatttgttcttgggcactaagcttacttttcagcatcccacaggtttatatattttcc
ttgcgggaggtgggttcaggagtatatgattgctggggagatttcgtgcagccgtgggga
gcgaaagcctacatcacgtggattagtctgacaatatacatcataccagtggccattctg
agcgtctgctacggactgataagttttaaaatatggcaaaactttaaaaggaagactaag
aaggaccagtgtatcactctcacacccaagacatcgaaaggcagcgcgctcgcgcgggtc
agcagtgtcaaactcatttccaaggccaaaatcaccaccgttaaaatgacctttgttatc
gtactggcttatatagtgtgctggactccgtttttctccgtacagatgtggtcagcatgg
gatcccgaagcaccaagggaaggtgagtttcttttaaaagtttga

DBGET integrated database retrieval system