KEGG   Sinocyclocheilus rhinocerous: 107750446Help
Entry
107750446         CDS       T04916                                 

Definition
(RefSeq) dihydropteridine reductase-like
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00790  Folate biosynthesis
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107750446
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     107750446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase Peptidase_S66
Motif
Other DBs
NCBI-GeneID: 107750446
NCBI-ProteinID: XP_016421303
Position
Unknown
AA seq 239 aa AA seqDB search
MAATEAHKVLVYGGKGALGSACVQYFRAKNWWVASIDLNANEEANANVTVKMTESFTEQA
NQVTADVGELLGADKVDAILCVAGGWAGGSAKAKTLYKNADLMWKQSVWTATICSHLATK
HLREGGLLTLAGAKAALGPTAGCIGYGMAKAAVHQLCQSLSAPNSGLPPGSAAVAILPVT
LDTPMNRKFMPDGDVSSWTPLEYISELFYKWTTGENRPPSGTLMQLVTADGETEATPVL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcagctacagaagcccataaagtgcttgtttacggaggaaaaggggctctgggatct
gcatgtgtgcagtacttcagagctaaaaactggtgggtcgcctctatagatctcaatgcc
aatgaagaagccaatgccaatgttacagttaagatgactgaatccttcactgagcaagcc
aaccaggtgacagctgatgtcggtgagctgttaggtgcagataaggttgatgcaatcttg
tgtgtggctggaggttgggcaggaggcagcgccaaggccaaaactctgtataagaatgct
gatctgatgtggaagcagagtgtgtggaccgccacgatttgcagtcacctagcaaccaaa
cacctgagagagggggggctgctcacactggcaggggctaaagcagcactgggtccaaca
gcaggatgcattggttatggcatggcaaaggcagcggttcatcagttgtgtcagagtctg
agcgcaccaaatagtggtcttcctccgggatctgctgcagtagcaatacttccagtgact
ttggatacacccatgaatagaaagttcatgccggatggtgatgtcagttcctggacaccg
ctggagtacatatcagagctgttctataagtggactacaggagagaacagacctccttca
ggtactctgatgcagctggttactgcagacggagaaacggaggctacaccggtgttatga

DBGET integrated database retrieval system