KEGG   Sinocyclocheilus rhinocerous: 107750582Help
Entry
107750582         CDS       T04916                                 

Definition
(RefSeq) myotubularin-related protein 1-like isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
srx04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107750582
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107750582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:srx01009]
    107750582
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107750582
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107750582
Protein phosphatases and associated proteins [BR:srx01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107750582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase DSPc 3-PAP Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 107750582
NCBI-ProteinID: XP_016421531
Position
Unknown
AA seq 698 aa AA seqDB search
MEKRQHSSGSESPVLPSVPRKPRNLGGAIPAPRQDGVDSLDSPTGSHVEWCKQLIAATIS
SQISGGVPPEAITRECKAGKKIDFKVSRRPNLRSQDSGEDDCQFDSDYELPSHTTQVFKD
VRRQAPMDEVPLVPGETIKTTVKDVMYICPFTGAVTGTLTVTDYKLYYVSLERNTLFILA
VNLSAISRLETISVQSLGENTSGMEIVCKDMRSPRFAYKKEEQSNLEILEVLTKYAFPLS
NELSLFAFQYKEQFPEDGWKVYDPVAEYKRMGLPNESWTISKINSNYEVCDTYPALLVTP
TSIKEDEIKRVVSFRVKHRIPVLSWIHPETQATIVRCSQPMVGPTDRRCKEDEHYLQAIM
DANAQSHKLTIFDARQSIVADNHKAKDGGYENENFYPNMDLNFLEIPNIHVMRESLRKLK
EVVYPTIDDPHWHSAIDATHWLQYIRLLLVGAVRIADKVESSKSSVVVHCSDGWDRTAQL
TSLAMLMLDSYYRTLRGFQVLLEKEWISFGHKFAARVGHGDENHANSERSPLFVQFIDCV
WQMMRQFPTAFGFNELFLITILDHLYSCLFGTFLYNSEQERVEKEVNSKTVSLWSYINSQ
PEDFTNPFYVDYENHVLYPLASLRHLELWVGYYVRWNPRMRPQMPVHQNLKELLYLRAEL
QRKVEELQKEASSSRSISSSSEHAYSPSNGGTPLHTSV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacggcagcattcgtcgggttcagagagtccggtgctgccgtctgtcccgcgt
aaaccgaggaacctcggaggagcaatccctgcacctcgacaagacggcgtggattcatta
gacagtcctactggatctcatgtggagtggtgtaaacagctgatagcggccactatctcc
agccagatctctggtggtgtccctccagaagccattacccgtgaatgcaaggctgggaag
aagatagatttcaaggtatccaggaggccaaacttgaggtctcaggactctggtgaagat
gactgtcagtttgacagtgactatgaactgccatctcacactacgcaggttttcaaggat
gtacgaaggcaggcgcccatggatgaagtcccactggtccctggagagacaatcaaaacc
actgttaaagatgtgatgtatatctgtcctttcactggagctgtgaccggcacactcact
gtcacagactacaaactctactatgtcagtctagaacggaacacactgttcatattggct
gtgaacctgagtgccatcagcaggttggagactatcagtgtacagagtcttggggagaat
actagtggcatggagatcgtctgtaaggatatgaggagtccgaggtttgcttataaaaag
gaagaacagagtaacctggagattttggaggtgttgaccaagtatgccttccccctgtcc
aatgagctgtccctattcgccttccaatacaaagagcagtttccagaggatggatggaag
gtttatgatccagtggcagaatataaaagaatgggtttgccaaacgagagctggaccatc
agtaagatcaacagtaattatgaagtgtgtgacacttaccctgcactgctcgtcacccca
accagtattaaggaggatgagatcaaacgagtggtctctttcagagtaaaacatcgcata
ccagtcctctcatggatccacccagaaactcaggccactatagttcgctgtagtcagccc
atggtgggcccgacagaccgccggtgtaaggaggatgagcattacctccaggccatcatg
gatgccaatgcacagtcccataaactcaccatatttgatgctcgacagagcattgtggct
gataatcataaggctaaggatggaggttatgagaatgaaaatttctatcctaacatggac
ctgaatttcctggaaatcccaaacattcatgttatgagagagtctctgcgtaagctgaag
gaggtggtctaccctaccatcgacgatccacactggcattcagccatagatgccacacac
tggctgcagtacatacggcttttgcttgtgggtgcagtgcggattgcagataaggttgag
tcgagtaagagctctgtggtggtgcactgcagtgacggctgggaccgcacagctcagctc
acctctctggccatgctgatgctggattcatactacaggactctcaggggcttccaggtg
ctgctggagaaggaatggatcagcttcggacacaagtttgctgcgcgtgttggtcacgga
gatgaaaatcatgcaaactctgagcgctcgcctctatttgtgcagttcatagactgtgtt
tggcaaatgatgagacagtttcccactgcctttgggtttaatgagctcttcctcatcact
atcctggatcacctctacagctgtctgtttggtacattcctttacaacagcgaacaggag
cgagtggaaaaggaagtgaacagtaaaacggtgtctttgtggtcctacatcaatagccag
ccagaggacttcaccaaccccttctatgtggactatgaaaaccatgttctgtaccctctg
gccagtctcagacatttggagctctgggttggatactacgtacgctggaacccccgcatg
agaccacagatgcctgtgcaccagaacctgaaggagctgctgtatcttcgtgcagagcta
cagaggaaggtggaggagttacagaaagaagcatcttcatcacgttcgatctcctcttca
tcagagcatgcgtattctccttcaaatggcggtacacctctacacacctctgtgtaa

DBGET integrated database retrieval system