KEGG   Sinocyclocheilus rhinocerous: 107751157Help
Entry
107751157         CDS       T04916                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00230  Purine metabolism
srx01100  Metabolic pathways
srx04270  Vascular smooth muscle contraction
srx04540  Gap junction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107751157
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107751157
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107751157
Enzymes [BR:srx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107751157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA DUF4820 Adeno_E1B_55K DUF1947
Motif
Other DBs
NCBI-GeneID: 107751157
NCBI-ProteinID: XP_016422270
Position
Unknown
AA seq 773 aa AA seqDB search
MHCTFHHKQHILLVVDKVKEKYGFINTCLKSLVIERFGEETWENLRLMAGVQETFMTYEI
YDDVITLSLVQEACKMLDVSSEVILKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLD
ALHSYLALSYEAMNAPSFRVERMDDGRILLHYYSDRKGLHHIVPGIIEAVAKDFFDSEVT
MTILNQSEEDERTGKKEHVVFHMVQKEKVTKRKAQPRQKGSTEEIQAEKEDKEETMKRMM
ARYACLQLCPRKRSTWEIVRSIVMLGQGNLRQSFTPSYPKRLWIEEQAFCNAFPFHIVFD
QDLVVKQTGVNIQKFVPGLQTAGIRLDEYFTIVHPEVIFNIQSIKKFINSQFVLKTRREM
LPEIHQNQSTLKLRGQMMWMESLNCMIYLCSPKLRSLQELEERGLHLADIAQHDTTRDLI
LLNQQRLAEIELSNQLERKKEELRILSRNLEIEKQKSEKLLYAMLPTHVANLLKEGKRVE
AGEFKVCTILFSDVVTFTNICAACEPIQIVNMLNAMYSRFDRLTNIHNVYKVETIGDAYM
VVGGVPVPTDTHAERVANFALGMRIAAREVISPITGQPIQIRVGLHTGSVLAGVVGDKMP
RYCLFGDTVNTASRMESHGVPDHIHLSPFTYSVLKDKGIFEIAERGEIEVKGKGLMRTFF
LLKNLQKSDEQIMGLVDGETCVYQEDPEDVTDAQNEVSPEDTDGGQKEEEKKELEVENPK
NHISSPSLCPGKISPDHLIQFDVTPAYESPTDFKHLHNGLHSDSISTKFCSIL
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgcactgtactttccatcacaaacaacatattctgctcgtggtggataaagtgaaagag
aaatacggctttattaatacgtgtctgaagtcactggtcattgaaaggtttggagaagag
acatgggaaaatttgagattaatggctggtgtccaggagacatttatgacatatgaaatc
tacgacgatgtcatcactcttagtttagtgcaagaggcttgtaaaatgctggatgtctcc
tccgaggtgattttgaagcttttcggagagtactttttcagcttttgtaagatgtccgga
tatgacactatgctgcgaacactcggtggaaacctggtggaattcattgaaaatcttgat
gctttacacagttatttggcattatcttatgaggccatgaatgctccgtcctttcgtgtg
gagcggatggatgatggccgaattctccttcactattactcagataggaaagggttgcat
cacatcgtgccaggtattatcgaggctgtggcaaaggatttctttgacagtgaggttacg
atgaccattctaaaccagtcagaagaggatgagcgcactggaaagaaggaacatgtggtt
ttccacatggtacagaaggaaaaggtgaccaaaagaaaggctcaaccaagacagaaaggc
agcactgaggaaatacaggctgagaaagaggacaaggaagagacaatgaagagaatgatg
gccaggtatgcctgcctgcagctgtgtccaaggaaacgatctacatgggagattgtgagg
agcattgtcatgttgggccaaggcaatctgcgacaatcgttcactcccagctacccaaaa
agactttggattgaagaacaagccttctgtaatgcttttccctttcacattgtttttgat
caagatctggtggtgaagcaaacaggtgtcaacattcagaagttcgttcccggactgcag
accgcaggtatccgtctggatgagtactttaccatcgttcacccagaggtcatcttcaac
atccagagcatcaagaagttcatcaacagccaatttgtgctgaaaaccaggagggaaatg
ttaccggagatccaccaaaaccagtccacactcaaactgagaggacagatgatgtggatg
gagtcactcaactgcatgatctatctgtgctctcctaagctacgaagcctccaggaactg
gaggagaggggtctccatctggccgacatcgcccagcacgacaccacacgagatctgatc
ctgctcaaccagcagaggttggcggagatcgagctctccaatcagctagaaaggaagaag
gaggagttgagaatcctctcacgcaatttagagattgaaaagcagaaatcagaaaagctt
ctttatgccatgctgccgacacacgttgccaacctgcttaaagagggcaaaagggtagag
gcaggtgagttcaaagtgtgcaccatcctttttagtgatgtggtcacattcactaacatc
tgcgcagcctgtgaacctattcaaatagtcaacatgctcaacgccatgtactccagattt
gatcgacttacaaacatccacaatgtctataaggtggaaactataggtgatgcttacatg
gtggttggtggtgtgcccgttcctacagacactcatgcagagcgggtggcaaactttgcc
ctcggtatgagaattgctgcgagagaagtaatcagccctatcacaggacagcccatacag
atcagagtaggcctgcacaccggttcagttttggcaggtgttgtaggtgacaaaatgcca
cgctattgcttgtttggagacacggtcaatacagcctctcggatggagagccatggagtt
cctgatcacatacacctgagccccttcacatacagtgtgttaaaggacaaaggaatcttt
gagatcgctgagaggggtgagattgaggtgaaaggcaaaggcctgatgagaacattcttc
ttgctgaagaacctccaaaagagcgatgaacagatcatgggcttggtcgatggagagacg
tgtgtgtaccaggaagacccagaggacgtgacagatgcccaaaacgaagtaagtcctgaa
gacacagacggtgggcagaaagaggaagagaaaaaggagttagaagttgaaaacccgaaa
aatcacatatcatcaccatctctctgtccaggcaaaatctcccccgatcatttaatccag
ttcgatgtaacgccagcatacgaaagccccactgacttcaaacatctacacaatggtctt
cattcagacagcattagtactaagttctgctcgatactttag

DBGET integrated database retrieval system