KEGG   Sinocyclocheilus rhinocerous: 107751588
Entry
107751588         CDS       T04916                                 

Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:srx04040]
    107751588
Ion channels [BR:srx04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   107751588
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 107751588
NCBI-ProteinID: XP_016422819
Position
Unknown
AA seq 500 aa
MKTSVMDLKVEAMDIDYDQPPPLQVFAHTSTLHGISHIFSYEKITAKCCLWVVFFLSSLT
FLMYVCVDRIQFYLEYPHVTKLDEITTPVMVFPAVTICNLNSIRFSRITRNDLYHAGELL
ALLNSRHEIRDAHLVEESVMEVLKSKADFRSFKPRPFNMWEFYNRTGHDIKDMLLSCQFR
GSLCRPEDFSVVFTRYGKCYSFNSGNTGAPLVSVKGGMGNGLEIMLDIQQDEYLPVWGET
DDSSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKSTPPS
SDYFKVYSISACRTDCETRYLVENCNCRMVHMPGDAQYCTPGLYKECAHPALDFLVERDS
DYCSCETPCNITRYSKELSFVKIPSKASVKYLAKKYSKSEKYITENVLVLDVFFEALNYE
TIEQRKAYEVAGLLGDIGGQMGLFIGASVLTILELFDYLYEVMKHRLCRCSDKKHHNNNN
TDHGTVLGLDDVKCHVSKFH
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaaaacatcagtgatggatctcaaagtggaagctatggacattgattacgaccagccg
cctcccctccaagtgttcgctcacacctcgactctgcacggcatctctcatatcttctcc
tatgagaagatcacggccaaatgctgcctctgggtggtgtttttcctcagctcactgacc
tttctaatgtacgtctgcgtcgatcgcattcagttctacctggagtaccctcacgtcacc
aagctggacgagatcacgacgcccgtgatggttttcccagcggtgacgatttgcaatctc
aactccatccgcttcagcaggatcacacgcaacgacctgtaccacgcgggcgagctgctg
gcgctgctcaactccagacatgagattcgggacgctcacctggttgaagaaagcgtgatg
gaggttctcaagagcaaagcagactttcgctccttcaagccgcgacccttcaacatgtgg
gagttctataatagaacaggacacgacataaaagacatgctgctctcctgccagttcaga
ggttccctgtgtcgacccgaagacttcagcgtggtattcacacgttacgggaaatgttac
agctttaactctggtaacaccggcgcgccgctggtcagcgtgaagggagggatgggaaac
ggcctggagatcatgctggacattcagcaagacgaatatttacctgtgtggggagagaca
gacgactcgtcgtttgaggcgggaatcaaagttcagattcacagtcaggacgagcctcca
tttatagatcagctgggcttcggagtcgcaccaggattccagacgttcgtttcttgccaa
gagcagcgactggtgtatcttcctgctccatggggcagctgcaagtcgaccccgccgagc
tcggattacttcaaagtgtacagcatcagcgcctgtcgaacagactgcgagacgcgctac
ctggtggaaaactgcaactgccgtatggtgcatatgcctggtgatgcgcagtactgcact
cctgggctatataaagaatgtgcacatccagcactagatttcctggtggagagagacagc
gattactgctcatgcgagactccgtgcaacatcacgcgctacagtaaagagctgtctttc
gtcaagatccccagcaaagcgtcggtcaaatacctcgcaaagaagtacagcaaatctgag
aaatacataacggagaatgttctagtgctggacgtgttctttgaggctctgaactatgaa
accattgagcaaaggaaagcctatgaggtggctggtctgttgggtgatatcggaggacag
atggggctgttcattggagccagtgttcttacgattttggagctttttgactacctttat
gaggtaatgaaacacaggttgtgccgctgctccgacaagaagcatcacaacaacaacaac
actgatcacggcactgtactcggcctggatgatgtcaaatgtcacgtcagtaaattccat
taa

DBGET integrated database retrieval system