KEGG   Sinocyclocheilus rhinocerous: 107751628Help
Entry
107751628         CDS       T04916                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00600  Sphingolipid metabolism
srx01100  Metabolic pathways
srx04020  Calcium signaling pathway
srx04370  VEGF signaling pathway
srx04371  Apelin signaling pathway
Module
srx_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107751628
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107751628
   04371 Apelin signaling pathway
    107751628
   04020 Calcium signaling pathway
    107751628
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     107751628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Orbi_NS1
Motif
Other DBs
NCBI-GeneID: 107751628
NCBI-ProteinID: XP_016422856
Position
Unknown
AA seq 500 aa AA seqDB search
MDEPDAAHQRNGPAAGASMHGLFTDADTGRLTHALTLSDSCLTVQNISSPSSSEHLDLRD
CLGSRAHRGECEDQSADLCVYFYPCRHRWMASGPVRQRDERSFRLALSTDDNDEDANLRE
AERWARAIRHNSARRPEHTHGVLFSEVRRPCGVMVLVNPQSGRGQAMAFYNGHIQRMLTE
ADIPHTLFITERQNHARDLVRSADLTQWDALVILSGDGLLFEVVNGLMDRPDWEKAIQTP
LGILPGGSGNALAASVHHYTRASPVWGEDLLTSCGFLLCKGLISKLDLISIRLSSGARLF
SFLSLAWGFVADVDIESEQFRQIGALRFLLSTLLRLAYLRIYQGKLAFLPAESQRESASA
GFSTADSRLPDHLLVPLEQPVPQDWTLVEEQEFVLVLAMFQSHLGEDLLAAPDARADDGL
IHLFYVTAGISRTMLLRLFWAMQSGTHLDWGCTHLVYRRVRALRLEPLSEAGVMTVDGER
VEYGPLQAQVHRGAARLISA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaccggacgcggcgcatcagcggaacgggcccgccgcgggtgcgagcatgcac
gggctgtttacggacgcggacaccgggcggctcacacacgcgctgactctgtcggacagc
tgcctgacggtccagaacatcagctccccttcatcgtcggagcacctggacctgcgcgac
tgcctggggagccgcgcgcaccggggcgagtgcgaggaccagagcgcggatctgtgcgta
tatttctacccgtgccggcaccgctggatggcctcgggtccggttcgccagagggacgag
cggagctttcggctcgcgctcagtacagatgataatgatgaggacgcgaacctgcgcgag
gcggaacgttgggcgcgcgccatcaggcacaacagcgcgcgccgcccggaacacacgcac
ggtgtgttgttctctgaggtccgccgaccgtgtggcgtgatggtattggtcaatcctcag
agtgggcggggccaagcgatggctttctataatggccacattcagcggatgctcactgag
gcggatataccgcacacgctcttcatcacagagcgtcagaatcacgcgcgggatctggtg
aggagcgctgacctgacgcagtgggacgctctggtcattctgtctggagacgggctgctg
tttgaggtggtgaacggtctaatggataggccggattgggaaaaggccatccagactcct
ctgggaatcctgcccggaggttcaggaaatgcactggctgcttccgtccatcactacaca
cgagcgtctccggtgtggggtgaagatctgctgaccagctgtggctttttgctctgtaag
ggtctgatctctaaactggacctgatctccatccgtctgtcgtccggcgctcgtctcttc
tccttcctgtctctggcctggggctttgtggccgacgtggacatcgagagcgagcagttc
cgccagatcggagcgctgcgctttctcctcagcacgctgctgcgtctggcctacttacgg
atctatcaggggaaactagcgttcctgcctgccgaaagccagcgagaatcggcctctgct
ggcttttctaccgcagacagccggctgcccgaccacctgctggtcccgctggagcagccc
gtcccgcaggactggacgctggtggaggagcaggagttcgtcctggtgctcgccatgttt
cagtcgcacctgggcgaggatctgctggcggctccggacgctcgcgccgacgacggactc
attcatctgttctacgtgacggcgggaatctcgcgcaccatgctgctgcggctcttctgg
gccatgcagagcgggacgcacctggactggggctgcacgcatctggtgtaccgtcgcgtg
cgagcgctgaggctggagccgctgagcgaggccggcgtgatgacggtggacggggagcgc
gtggagtacgggccccttcaggcacaggtgcacagaggagcggcccgcctcatctccgca
tga

DBGET integrated database retrieval system