KEGG   Sinocyclocheilus rhinocerous: 107752009
Entry
107752009         CDS       T04916                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107752009
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107752009
Transcription factors [BR:srx03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107752009
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED Zn-ribbon_8 zf-met
Other DBs
NCBI-GeneID: 107752009
NCBI-ProteinID: XP_016423334
Position
Unknown
AA seq 1253 aa
MRSKGRARKLTTGDGEDFSLFASDDLEEVGGVSDADPVPLATANDLPSPGLSGDALSPVD
QSPFYPSFHTSVYLDGDGVESVPPDFEVRESAVTRGTLGIWSRRRLEVGERLGPYEETSR
HIPENATQAWEGEQTGLDGSVCDSRSWLRHVQISPSTHKHNLTACQIHEQIFYRVVREVQ
PGEELLLFMKAEDFSCETMAPDIHEERQYRCEDCDLNFESGSELLDHQKHACGTPPSSGF
KLSKQGLPSAVDDPDLDPLHLHTHPLNLPHSPQECKECEQVFPDAQSLDAHSLSHSDERE
YKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHAC
PDCGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDC
SQMFSTTSSLNKHRRFCEGKNHFAAAAGGLFAQGMALPGTPGLDKSALAGMSHGSPGLAD
YFGTNRHHGGLTFPAAPPAFPFSFPGLFPSGLYHRPPLIPSTSPINGPPSGELRKSPLLS
SPISGSHDLLKSLRKDSFNGESESMEHQREGSISKPRHGGKMSDQSESSDLDDVSTPSGS
ELESTSGSELDSEAESDRERVRVPENGKGPKRKSSGFNDAQSPTLVSSSSSSNTNNGKDF
PVPGLLPPSLDEQTAVSGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGALPYPSMFPLS
FFPAFSPSVYPFPEREQLRPPGPKGEPESPPVEGKKRKGRNAESPFDLTTKRKEERLAAT
CAPLKPEASHVQSANQDQPLDLSLGGRSRGKSVRGKELKKNPVFEEERVQPEPPKADPSL
QHARPTPFFMDPIYRVEKRKMNDPFEVLKDKYMRPTPGFLFHPQFRMPDQRTWMSAIENM
AEKLESFGSLKPDGGDIMRSVPSMFDFRAPPTTLPETLLRKGKERYTCRYCGKIFPRSAN
LTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDR
HLKKHENGTAMSSPRSELDSGSAILEDKEDSYFNEIRNFISNTARNATSPSHSEEGLNGS
HFDGDKALPGKGSRDLDEEGEELRAEEEEAEHSDSARKPSEDGVPSSLDHDINDDIDFEG
PDDLEMNSKSSPQRFNEEEDDEDHSSFSTLDHIRHFSMEDGDLSDSDVTSFGPAHLQEGI
KQPLYRKSKSQAYAMMLSLADKDPLHSSTHNAPMWHSLARAAEPSAIQSLSHV
NT seq 3762 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcaaggaaactgaccactggagatggagaggacttctctctt
ttcgcctctgatgacctggaagaagttggcggagtgtctgatgcagatccagtcccactg
gccactgcaaatgaccttccgtcccctggcctatcaggtgatgcgctttccccagtcgac
cagtcccccttctacccgtcattccacacttcagtgtacctggacggggatggggtcgaa
tcggtgcccccagactttgaggtccgcgagtcagccgttaccagaggaaccctgggcatc
tggagccggaggagactggaggtgggagaacgtctcggaccttatgaggaaacgtcaaga
cacatcccagaaaatgccacccaggcatgggagggcgagcagacaggtttggatgggagc
gtgtgtgatagcaggagctggctaaggcacgtccagatctctccatccacccacaaacac
aacctcacagcctgccagatacatgagcagatcttttaccgtgtggtccgagaggtccag
ccgggtgaggaactcttactgttcatgaaggctgaggatttttcatgtgagaccatggct
ccagacatacacgaggagcgtcaataccgttgtgaggactgtgacctgaactttgagtct
ggttcggagctgctggaccatcagaagcatgcatgcggtaccccgccttcctccggcttc
aagctgtctaagcagggtctgcccagcgccgtggacgatcctgatcttgacccactgcac
ttacacactcaccccctgaacttaccccactccccacaggagtgtaaggagtgtgagcag
gtctttcctgatgcccagagtctggacgctcactctctgtctcactccgatgagagggaa
tataaatgtgatcagtgtccgaaggccttcaactggaaatcaaacctgattcgccaccag
atgtcacatgacagcggcaagcattatgaatgtgaaaactgctcaaaggtgttcacagac
cccagtaacttgcagaggcacattcgctctcagcatgtaggggcgagagctcacgcctgc
cccgactgcggcaagaccttcgccacctcctcgggccttaaacaacacaaacacattcac
tcttccgtcaagcccttcatatgtgaggtctgccacaaatcttacacgcagttctccaat
ctgtgccgccacaagcgcatgcacgcggactgtcgcactcagatcaagtgcaaagactgc
agccagatgtttagcaccacgtcgtccctaaacaagcatcggcgcttctgcgagggtaaa
aaccattttgctgctgccgcgggagggttgtttgcccagggcatggccctccctggcacc
cctggcctggacaaatccgcactggctggaatgagccatgggagtcctggtttagcagac
tattttgggacgaaccggcaccatggtgggctgacattcccagcagcccctccagcattc
ccattcagttttccaggacttttcccatcaggactttaccaccggccccctctaatccca
tccacgtcacctattaacggccctccgagcggtgaactacgaaagagtccgctgctgtct
tcacccatctctgggtcacatgacctcttgaagagtttacgcaaggattcgttcaacggg
gagagcgagagcatggagcatcaaagggaaggatccatctccaaaccaaggcacggcggg
aagatgagtgaccagtcggagagtagcgatctggacgacgtcagcactccgagcgggagt
gagctggaaagcacttcaggttcagagttggacagcgaagccgaaagcgaccgggaacga
gtgcgagtgccggaaaacgggaaaggcccgaaaaggaagtccagcgggttcaacgatgcc
caaagcccgactcttgtcagctccagtagtagtagcaacaccaataacggaaaagacttc
cctgtgccagggctcctcccgccatctttggacgagcaaacggctgtttctggtgccgtt
aatgactcgatcaaggcaattgcctccattgctgagaaatactttggttctactggactt
gcaggcctgcaagataaaaaagttggggcattgccatacccttccatgttccctctgtct
ttcttccctgccttctctccgtcagtctatcctttcccagaaagggagcaacttagacct
ccaggccccaaaggggagccagaaagccctccggttgagggaaaaaaacgtaaaggcaga
aacgctgaatcaccttttgacctcaccaccaaacggaaggaagaacgtcttgccgctact
tgcgcccctttgaaaccggaagcctcacatgtacaatcagccaaccaggatcaaccgctg
gacctgagtctcggtggacgaagtcgaggaaagagtgtaagagggaaggagttaaaaaag
aaccctgtctttgaagaggagagggtgcaaccggagccacccaaggccgacccgtccctc
caacacgcaagacctacgcctttcttcatggatcccatttacagggttgagaagagaaag
atgaacgatcctttcgaagtcctcaaggacaagtatatgcggcccactcctggatttctc
ttccacccgcagtttcgcatgcctgatcagagaacatggatgtcggcgattgaaaacatg
gctgaaaaactggaatccttcggctctttgaagccagacggcggtgacatcatgcgttcc
gttccttccatgttcgacttccgggctccgcccaccacccttcctgagacactgttacgc
aaaggcaaagagcgctacacctgcagatactgtggcaagatattcccacgctcagccaac
cttacaagacatctacggacacacacaggagagcagccttacagatgtaagtactgcgat
cgttcgttcagtatttcgtcgaatcttcagcgtcacatccgtaacatccataacaaagag
aaacccttcaaatgccatctttgtgaccgctgcttcgggcaacaaaccaatctggaccgg
cacctcaaaaagcacgagaacggcacggcaatgtcgtcgccccgttcagagctggacagt
ggcagtgccatcttggaggacaaggaggactcgtattttaacgaaatacgaaacttcatc
agtaacacggcacggaacgccacttctccgtcacactccgaggaagggctaaacggcagt
cattttgatggcgacaaagccctgcctggtaaggggtcacgtgacctggatgaagaaggg
gaggagctcagagctgaggaagaggaggcggagcatagcgacagtgccaggaaacccagc
gaggatggcgtgcccagcagtctagatcacgacataaacgatgacatcgatttcgaggga
ccagatgatctggagatgaatagcaaatcctcgccacaaaggtttaatgaggaagaggac
gatgaagatcacagcagtttctccacgctggatcacatccgtcactttagtatggaggac
ggagacctcagcgacagtgatgtcaccagctttggccccgcccacctgcaagagggcatc
aagcagcctctatacaggaaatctaaatcacaggcatatgctatgatgctgtccctagct
gataaggatccactccattcgtctacccataatgccccgatgtggcacagcttggcccgt
gctgcagaacccagcgccattcagtctctcagtcacgtatga

DBGET integrated database retrieval system