KEGG   Sinocyclocheilus rhinocerous: 107752943
Entry
107752943         CDS       T04916                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00230  Purine metabolism
srx00240  Pyrimidine metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107752943
   00240 Pyrimidine metabolism
    107752943
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107752943
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33
Other DBs
NCBI-GeneID: 107752943
NCBI-ProteinID: XP_016424512
UniProt: A0A673NED9
Position
Unknown
AA seq 263 aa
MSPTAKRACPSPLNDSLEKRLKRISIEGNIAAGKSTFVRLLDEHDREWEVVPEPIARWCN
VQTHHSEHEELTTSQKSGGNVLQMMYEKPDRWAYTFQSYACMSRIRSQIRSTNGKLREAE
NPVQFFERSVYSDRYIFASNLYESECVNETEWAIYQDWHSWLHKQFGKHIELDGIIYLRA
KPERCLERLYLRGRDEEQGIPLEYLEKLHYKHESWLQHRTMSMEFEYLNEVPVLTLDVND
DFKDDKIKCADMIEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtctcccactgccaaacgagcctgtcccagtcctctgaacgacagtctggagaaaaga
ctgaaacgcatctccattgaaggaaacattgccgcaggtaaatccacttttgttcgcctg
ctggatgaacatgatcgagaatgggaggtagtaccggaacccatcgctagatggtgcaat
gtacaaactcaccacagcgagcatgaggaattgaccacctctcagaagagtggaggaaat
gtgctgcagatgatgtacgagaagcccgatcgctgggcctacaccttccagagttacgcc
tgcatgagccgcatccgctcgcagatcagatccaccaacggaaaactgcgagaggctgag
aatccagtgcagttcttcgaacgatccgtgtacagtgacaggtacatctttgcctctaac
ctctatgaaagtgagtgtgtgaatgaaaccgagtgggcgatctatcaggactggcacagc
tggctgcataagcagtttgggaagcacattgagctggacggcatcatttacctgcgggca
aaaccagaaaggtgtttggagcgattgtatttgagaggaagagacgaggaacagggaatt
ccactggaatatctggagaaactccactataaacatgagagctggctacagcacaggact
atgagtatggagtttgagtatctgaatgaagtgccggttcttaccctggatgtcaatgac
gattttaaagacgacaagatcaagtgtgctgatatgatcgagaaggtgaaagaatttctg
agcaccctgtga

DBGET integrated database retrieval system