KEGG   Sinocyclocheilus rhinocerous: 107753454Help
Entry
107753454         CDS       T04916                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00010  Glycolysis / Gluconeogenesis
srx00562  Inositol phosphate metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107753454
   00562 Inositol phosphate metabolism
    107753454
Enzymes [BR:srx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107753454
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107753454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107753454
NCBI-ProteinID: XP_016425082
Position
Unknown
AA seq 458 aa AA seqDB search
MKTTYFLANFLITSLSIMVGLSLSKLARPTIPAIAHHFGTKGRYEEVNPHLLDDILFVNK
SLVAPPSPDCRAIHMVSVIRHGTRYPTTKNVKKIARLFELVVSHASGSASWLNDIKTWKM
WYTEDMDGRLVEKGCDDHRHLAVRLAQSFPTLISEDHLRANRIEFITSSKHRCVDSVKAF
QEGLHRLWDVQDMDYKHYVDDSLMRFFDHCERFVESVEKNKTALKEVERFKSSAEMDAVR
RKISSRLQIPYSQFTPDMAEAAFFLCSYEFAIKSENSPWCDLLDESDAQVLEYKNDLKQY
WKRGYGHDVNRKSSCPLFHDIFKRLEKAANDYRFGGVKKTATIQVGHGETLLPLLSLMSF
YKDEKPLTAENFSLQHNRTFRSSQIVPYAANLVFVLYECSDGLRIQLFLNEKLMTFPNMN
HLAPLYETVRKHYSKLLNGCEFNKECNVPQSNLRNTEL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacttacttcctcgcgaactttcttatcacttctttgagcattatggttggt
ttgtcattatctaaacttgccaggccaacgataccggcgatagcgcatcactttgggaca
aaaggcaggtacgaggaagtgaacccacatctattagatgacattttgtttgtaaacaaa
tcactggtagctcccccctctccagattgccgtgccattcatatggtgtcggttatacgt
cacgggacgcgctatccaaccaccaaaaatgtgaaaaagatcgcgcgattgtttgaactg
gtcgtgtctcacgcgtcgggttcagcctcgtggctaaatgacattaagacatggaaaatg
tggtacactgaagacatggacggcagactggtggagaaagggtgcgatgaccacaggcat
ttggctgtgagactggcacagtcgttccccactttgatttctgaggatcatctccgtgcc
aaccgcattgagttcatcaccagctccaagcatcgctgtgttgatagtgtcaaagctttt
caagagggtcttcaccgactctgggatgttcaggatatggattacaaacactatgtggat
gattcactcatgagattctttgaccattgcgagagatttgttgaaagtgttgagaaaaac
aaaacagctttgaaggaggtagaacgctttaaatcttcagcagaaatggatgcagtacgg
aggaaaatatccagtcgccttcagattccatacagtcaattcaccccagatatggcagag
gcagctttctttttgtgttcctatgagtttgccatcaaatcagagaactccccttggtgt
gatctgctggatgagtctgacgctcaagtcctcgagtacaaaaatgacctgaaacagtac
tggaagaggggatatggacatgacgtcaaccgtaaatccagctgccctctctttcatgat
attttcaagcgtcttgaaaaggctgctaatgactacagatttggaggggtaaaaaagact
gccaccatccaggttggacatggtgaaaccctgctgcctctgctctctctgatgtccttc
tataaggatgaaaaacctttaactgcagagaatttttcattgcagcacaaccgcacattc
cgctccagtcagattgtaccttatgctgcaaacttagtctttgtcctgtacgaatgcagt
gatggactcagaatacagttgtttctcaatgagaagttaatgacctttcccaacatgaac
catttggctccactgtatgaaacggtcagaaagcattactcaaagctccttaatggctgt
gagtttaataaggaatgtaatgtgcctcagtcaaacctcaggaacactgaactttga

DBGET integrated database retrieval system