KEGG   Sinocyclocheilus rhinocerous: 107754064Help
Entry
107754064         CDS       T04916                                 

Definition
(RefSeq) ankyrin repeat and SOCS box protein 13-like isoform X1
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:srx04121]
    107754064
Ubiquitin system [BR:srx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     107754064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank_5 Ank SOCS_box
Motif
Other DBs
NCBI-GeneID: 107754064
NCBI-ProteinID: XP_016425863
Position
Unknown
AA seq 307 aa AA seqDB search
MELTAARSTFYGDIGHWADRTPVHEAASLGRALQLKQLIEAGASVNIVSVDNFTPLHDAC
IQAHPKCVQILLEAGAQVDVRTIHGSTPLCHACAAGSIESVKLLVDHGASVNPSLTALTA
SPLHEACIRGEIARRGYALCLDCLFSHDLCAGSPDCVKLMIDKGALLEAFDIYFGTPLHA
ACAKAHLDCALLLLNAGAKVNATKFHETALHHAARAERVDLVELLVEFGGNVNISDNLGH
KPRDYTKPESPANLCLLHYESNFLSLQQLCRIVLRTVLGARALELIPKLDISQRIIDYLI
YKSYIYK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaactcaccgctgccagatcaacgttttatggtgacatcggtcactgggctgaccgc
acgccggtacacgaggctgcgtctctaggtcgagcgctgcagttaaaacagctgatagaa
gcaggagcatcagttaatatcgtgtctgttgataacttcacccctctgcatgatgcctgc
atccaagcccatccaaagtgtgttcaaatcctgctggaggctggagctcaggtggatgtg
cgcaccatccatggcagtactcctctctgtcacgcctgtgcggctggcagcatagaaagt
gtcaagctgctggtggatcatggagcgtccgtcaacccttccctgaccgccctcacggct
tcacccctccatgaggcctgcatacgaggtgagatagccaggagagggtatgctttgtgt
ttagattgtttgttttctcatgatctctgtgcaggtagcccagactgtgtgaagcttatg
atagacaagggagcgctgctggaggcctttgacatttacttcgggacgccgttacatgct
gcttgtgctaaagctcacttagactgtgccctgctgctgctcaatgcaggtgcaaaggtg
aatgccaccaagttccatgagacggcactgcatcatgcggcgagggccgagagagtggac
ctggtggagctgctggtggagtttggtggaaatgtcaacataagtgataacttgggtcac
aaacctagagactatacaaaacctgaatctcctgccaatctctgtctgctgcactatgag
agtaactttctgtctctgcagcagctgtgccgtatcgtcctgaggactgtgttgggtgct
agagctctggagctgatccctaaactggacatttcacagcgcatcattgattacctcatt
tataaatcatacatttataaataa

DBGET integrated database retrieval system