KEGG   Sinocyclocheilus rhinocerous: 107755117Help
Entry
107755117         CDS       T04916                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107755117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:srx04030]
    107755117
G protein-coupled receptors [BR:srx04030]
 Rhodopsin family
  Lipid
   Leukotriene
    107755117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx PSD5 RAI1
Motif
Other DBs
NCBI-GeneID: 107755117
NCBI-ProteinID: XP_016427302
Position
Unknown
AA seq 356 aa AA seqDB search
MNATAYFQADEETELGLVGACVILGVCFLVGTPGNLLVVWTILKHVKQRSHTVLLILHLA
AADLLVLITLPLWIYSPARSWVFGEAACKAMVYIINACMYSSVFIITTMSVERFLAIRYP
FASVVWRRRQALNKVLLMIWMASFLLSIPVIVTHTLGEVHGQNQCLFREYETDAQEGVLL
ILESLIGFVIPFFTLLVCYGCLFSRIVQMNFKSKRKSTVLICSVVVMFALCWIPHHAGNF
LALISLALKHSSPDMAESLEDACTTMTFIAGALTFISSSVNPVLYVFAARAFRSSLRETG
IQKLFQHLSSAASGEGNKELSFVSKRQSSHSTNSQCLTDSKVPVDVAMESCISTSD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctacagcttattttcaggcagacgaggagaccgagctgggcttggtgggggcc
tgtgtgattctgggtgtgtgtttcctagtgggtacacctgggaacctgctggtggtgtgg
accatcctgaagcatgtgaaacagcgttcacatacggtgcttctcatcctccacctggca
gctgcagatcttctggtgctgatcactctgccgctgtggatctactcgccggcccgttcc
tgggtgtttggagaggcagcctgcaaagccatggtgtacatcatcaatgcctgcatgtac
agcagcgtcttcatcatcaccaccatgagtgtggagcgcttcctggccatcagatacccc
tttgcctcagtcgtctggaggaggagacaagcactgaacaaggtacttctaatgatatgg
atggcttcatttctcctcagtattcccgtcattgtaactcacactttgggagaagttcac
ggacaaaatcaatgtctgttcagggagtatgagactgacgcccaggagggtgtgttgctc
attttagaatctcttataggttttgtcatcccttttttcactctgttggtctgttacggc
tgcctcttcagtcgcatagtgcagatgaacttcaagtccaagcgcaagtcgacggttctc
atctgcagtgtggtggtgatgttcgctctctgctggattcctcaccatgcagggaacttt
cttgccctcatctcgctcgctctcaagcattcaagccccgacatggcggaaagtttggag
gacgcctgcaccacaatgacctttatagcaggagccctgacattcatcagtagctcagtc
aatccagtgctttatgtgtttgccgcgcgtgccttccgcagctcgctccgggaaactgga
atacagaagctcttccagcatttgtccagtgcagcatcaggtgaagggaataaagagtta
tcatttgtgtccaaaagacagagttcacacagcaccaactcacagtgtctcacagactca
aaagtgccggtagatgtggctatggaatcatgcatcagtacttcagactga

DBGET integrated database retrieval system