KEGG   Sinocyclocheilus rhinocerous: 107756157
Entry
107756157         CDS       T04916                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00230  Purine metabolism
srx00240  Pyrimidine metabolism
srx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107756157
   00240 Pyrimidine metabolism
    107756157
Enzymes [BR:srx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107756157
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 107756157
NCBI-ProteinID: XP_016428657
UniProt: A0A673IMV8
Position
Unknown
AA seq 264 aa
MATPPKRFCSSLDADLSFEKRALKISVEGNIAAGKSTFVRCLERASEEWEVIPEPIGKWC
NVQTTENEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQTYACLSRVRAQLQPPSAKLQQA
EQPVQFFERSVYSDRYVFASNLFESGDLNETEWAIYQDWHSWLLTQFESQIELDAMIYLR
ADPERCMQRLQFRGREEEQGIPLDYLEKLHYKHECWLYNRTTKLDFEYLKDLPILLLDVN
EDFKNDRIKQEGIIDKVKEFLSTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggctactcctcccaagagattttgttcaagccttgacgctgacctcagtttcgaaaaa
agggcattgaagatctcagtagagggaaacattgcggcagggaagtcaacttttgtgcgt
tgtttggagcgggcctcagaggagtgggaggtcataccagagcccattgggaagtggtgc
aatgtacaaaccacagagaacgagtatgaggagctcagcacgtcccagaagagtggaggc
aacctgctgcagatgttatatgacaagcccagtcgctggtcttacactttccagacgtac
gcctgcttgagtcgtgtccgtgcacagcttcagcctccttctgccaaacttcagcaggca
gagcaaccggtccagttctttgagcgctctgtctacagcgatcgatatgtgtttgcctct
aacctctttgagtctggagatctgaatgagacagagtgggccatttatcaagactggcat
tcgtggctcctcactcagtttgagtcccagattgagcttgatgccatgatctatcttcgt
gctgatcccgagaggtgtatgcagcgtcttcagttcagaggacgagaggaggaacaaggg
attcccctggattacctggagaagctgcattataagcatgagtgttggctgtacaatcga
accacaaagttggattttgagtatcttaaagaccttccaatactgctcctggatgttaat
gaggattttaaaaatgacagaattaagcaagaaggtatcattgataaggtgaaggagttt
ttgagcaccctctag

DBGET integrated database retrieval system