KEGG   Sinocyclocheilus rhinocerous: 107756175Help
Entry
107756175         CDS       T04916                                 

Definition
(RefSeq) dipeptidyl peptidase 3-like isoform X1
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:srx01002]
    107756175
Enzymes [BR:srx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     107756175
Peptidases [BR:srx01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   107756175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 107756175
NCBI-ProteinID: XP_016428692
Position
Unknown
AA seq 750 aa AA seqDB search
MLLIISWISLKEKPGEGSSCLKTEMVDSQYYLPNDIGISALDCREAFRLLSPKEQMYAHY
LSRASWYGGLIVLIQTSPESANIYVLLQKMFRAQAPQQLEAAATAAGLSAEEYQAFLVYA
AGLYANMGNYKSFGDTKFIPNLPKEKFKALVWESLAFKQSPGDMEALWGCCSESLYSLED
KQKQLGLGEKGISAYFSGNCCLEDAEFAQKFLDSKNLSAYNTRLFKTEIDGKRCYEVRLA
SAEKDNCAVEGKSEVCCGKHEFEDAVFSVKRGDYAFLMEKVCQNLEKAKDYAANDNQKRM
LEEYSRSFTCGSVEAHKEGSRYWIKDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNK
AMSARFAQLVSSAEDLLPELPWPPAFEKDRFLKPDFTSLDVLTFAGSGIPAGINIPNYDD
IRQTEGFKNVSLGNVLAVAYATQKDKLTFLEENDKDLYIKWKGPSFEVQVGLHELLGHGS
GKLFVQDDKGKFNFDQTAVRNPETGELISSWYKGSETWDSKFSTIASSYEECRAECVGLY
LCLNKEVLRIFGNEGGDAEEVVYVNWLNMVRAGLLGLEFYTPESKSWRQAHMQARFVILR
VLLEAGEGLVGLKECMGADGRSDAVITLDRSKIYTVGKSAIQRFLCKLQVHKSTADVEGG
RALYEGYSAVTADGTHNFLRLRETVLLRKEARKMFVQANTYIKDDAVELVEYEGSAAGLI
QSFVERFPDDAEKVEAQLLEMTCMDSSCWC
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaataatctcttggatatcgcttaaagagaaacctggagagggatcaagctgc
ctaaagactgaaatggtggactctcagtattacctcccaaatgacatcgggatctctgct
ctggactgccgggaggctttcaggctgctgtctcccaaagagcaaatgtatgcacactac
ctctctcgggcatcctggtacggtggcctgatcgtgctgattcagacgtctcctgagtct
gccaacatctacgtactgctgcaaaaaatgttccgcgctcaggcgccacagcagctggag
gcagcagcgactgcagctggactgagcgcagaggagtatcaggccttcctcgtatatgca
gctgggctttatgcaaacatggggaactacaagtcatttggggacaccaaattcatcccc
aacctaccaaaggagaagttcaaggctctggtgtgggagagtctggcctttaaacagagc
cctggtgacatggaggcgctgtggggctgctgctctgagtccctctactccctggaagac
aagcagaaacagctcggtctgggtgagaagggcatctcggcgtacttctcagggaactgc
tgcttagaagacgcagagtttgcccagaaatttctggactccaagaacctgagtgcctac
aacacccgtctgttcaagactgaaatagatgggaaacggtgctatgaagtgcgtttggca
tctgccgagaaggacaactgtgctgttgagggaaagagtgaagtttgttgtggcaaacat
gaatttgaggatgctgtgttctctgttaagaggggcgattatgcctttcttatggaaaaa
gtgtgtcagaacttggaaaaagccaaggattatgcagccaatgacaaccagaagaggatg
ctggaggagtacagccgcagtttcacctgtggctcagtggaagcccataaagaagggtcc
cgttattggatcaaagacaaaggacctattgtggagagttacattggttttattgagagc
tacagagatccctttggctcaaggggtgaatttgaaggttttgttgctgtggtgaacaag
gccatgagcgctcgctttgctcagttggtgagctcggctgaagacttactaccagagctg
ccttggcctccagcctttgagaaagaccgcttcctcaagccagacttcacctctctggat
gtactcacctttgccggcagcggcatccctgcaggaatcaacattccaaactatgacgac
atcagacagacagaaggtttcaagaacgtgtcccttgggaatgtgctggcagttgcatat
gccacacagaaagacaagctcaccttccttgaggagaatgacaaagacctgtacatcaaa
tggaagggtccttcgtttgaggtgcaggtgggacttcacgagctgctgggtcacggcagc
gggaagctctttgttcaggatgataagggaaaattcaacttcgatcaaactgctgttcgt
aatccagaaacaggagaactgatctcaagctggtacaagggtagcgagacatgggacagc
aagttctccaccattgcctcgtcctatgaggagtgtcgagccgagtgtgtaggtctctac
ctgtgtctcaacaaggaggtgctccgtattttcgggaatgaagggggggatgcagaggag
gttgtgtatgtgaactggctgaacatggtgcgtgccggcctgctggggctggagttctac
acgccagagagcaagagctggagacaggcacacatgcaggcccggtttgtgattttgcgg
gttctgctggaggctggagaggggctggttggtctgaaggagtgtatgggggcagatgga
cggtcagacgctgtcataacactcgaccgcagcaagatatacacagtgggaaagagcgcc
atccagaggttcctctgtaaactgcaggtgcacaagtccacagctgatgtggagggagga
agggctttgtatgaaggctactctgccgtgaccgctgacggcacccacaatttcctgcgc
ctcagagagacggttctgctccgtaaggaagctcgcaagatgtttgtccaagctaacacc
tacatcaaagatgacgctgtggagctggttgagtatgaaggcagtgctgcaggactcatc
caatccttcgtcgaacgcttcccagacgatgcagagaaggtagaggcccagctgctggaa
atgacctgcatggactcgtcctgctggtgctga

DBGET integrated database retrieval system