KEGG   Sinocyclocheilus rhinocerous: 107756846Help
Entry
107756846         CDS       T04916                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like isoform X1
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:srx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107756846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:srx03110]
    107756846
Enzymes [BR:srx01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107756846
Chaperones and folding catalysts [BR:srx03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    107756846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 107756846
NCBI-ProteinID: XP_016429634
Position
Unknown
AA seq 164 aa AA seqDB search
MARPRVFFDITANGSPVGRVIMELRADVVPKTAENFRQLCTGQPGFGYKGSTFHRVIPGF
MCQGGDFTNHNGTGGKSIYGHKFEDENFTLKHTIAGCLSMANAGPNTNGSQFFICTAVTS
WLDGKHVVFGQVVEGLDVIKKVEGYGSSSGKTSAKIIVADCGQL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcccagagttttcttcgacatcaccgccaacggcagtccagttggaagagtg
ataatggagctgagagctgatgttgtccccaaaactgcagagaacttcaggcagctgtgc
accggtcagcctggcttcggctacaaaggctccaccttccatcgcgtcatccccggcttc
atgtgccagggaggcgacttcacgaaccacaacggaactggtggaaagtccatttatggc
cacaagtttgaggatgagaacttcaccctgaagcacaccatcgctggctgcctgtccatg
gccaacgccggccccaacaccaacggttcccagttcttcatctgcacagcagttacttca
tggctggacggtaagcacgttgtcttcggacaggttgtggagggcttggacgtcatcaag
aaagtggagggctacggttccagcagtggaaagaccagtgccaagatcatcgtcgctgac
tgtggccagctgtaa

DBGET integrated database retrieval system