KEGG   Sinocyclocheilus rhinocerous: 107757329
Entry
107757329         CDS       T04916                                 

Definition
(RefSeq) delta(14)-sterol reductase-like isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
srx  Sinocyclocheilus rhinocerous
Pathway
srx00100  Steroid biosynthesis
srx01100  Metabolic pathways
Module
srx_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:srx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107757329
Enzymes [BR:srx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107757329
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF2070
Other DBs
NCBI-GeneID: 107757329
NCBI-ProteinID: XP_016430261
Position
Unknown
AA seq 468 aa
MTTHQPEHQRHRNRSLQDTGNVKLEYGADDEGKGVVQVHSRWNNIHLSLVCVLLGISLIM
ILDGCRSSSESWVLLGSAGTLIWDWTSVCVVLLFTVLQVALYYLPVGQVTEGKMGCDGKR
LKYKLNGLHAFLLTVVLMLVLWFAGVLRAGAGTVRIFSLVSAAMAVSLIFSLTLFLCPIR
TPSSAHVTYNTGMTPQLLPVYPQRLRSEVMCVCLCCTAKPLLKFVLGHSMDPRLGLIDVK
HFVMVRVGFIGWAVMDLNYLLTAVEMKNSSLALLLVVVFQLIYILDFLVDEGSVLTTKEF
TDEPIGFIMILGEFIWIPFFSSLPAYFLLQRPNHIHFLSAVPICLLFAAGFLMYYLSNEQ
KDGFRRNPSDPAYARLNTIRSPAGSSLLVSGWFGWVRHPNYSGDILMMFAWCLPCGFTSV
LPYLPALQCFHLLRQRANEIEESCLKKHRDAWREYCRRVPYKLLPCVY
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgacgactcaccaaccagaacatcagaggcacaggaacagatccctgcaggacacgggt
aacgtgaagcttgagtatggagctgatgatgagggcaaaggtgtggtacaagtccacagt
agatggaacaacatccacctgtctctggtgtgcgttttgttgggcatctctctcataatg
atactggatggctgccggtcctcctctgagtcgtgggttctgctgggttctgctggaacc
ctgatctgggactggacgtctgtgtgcgtggtgctgttattcactgtcctgcaggtggcg
ctctattatctacctgtgggacaggtgacagaaggcaagatgggctgcgatggaaagcgt
ttgaaatacaaactcaacggtctgcatgcgtttctcctgactgtggttctgatgctggtt
ctgtggttcgctggtgttctgcgggccggtgctgggacggtcaggatcttctctctggtg
agcgcagccatggccgtctctctgatcttcagcctcacgctgttcctgtgtccaatcaga
acgccgtcctccgcacatgtgacctacaacaccggtatgacccctcaactcctccctgtc
tatccacagcgcctgaggtcagaggtcatgtgtgtgtgtttgtgttgcacagcaaagccc
ctgctgaagtttgttctgggtcacagtatggatcctcgtctgggcctcatcgacgtcaag
cacttcgtgatggtcagggttgggtttatcggctgggccgtgatggatctgaattatctc
ctgactgctgtagagatgaagaactcgtctctcgctctgctgctcgtcgtcgtcttccag
ctcatttacatactggacttcctcgtcgatgagggctctgtgctgacgaccaaagagttc
acggacgagccgattgggttcatcatgattttgggcgagtttatctggatccctttcttc
tccagtctgcctgcttacttcctgcttcagagacccaatcacatccacttcctgtctgcc
gtccccatctgtctgctcttcgctgctggcttcctgatgtattacctgtctaacgagcag
aaagatggtttccgcagaaatcccagtgatccggcctacgctcgtctgaacacaatccgc
agcccggcgggaagcagtctgctggtgtccggatggttcggatgggtccgacaccccaat
tactcaggagacatcctgatgatgtttgcctggtgtctgccatgcgggttcaccagtgtt
ttgccgtacttgccggcgctacagtgctttcatttattgaggcaacgagccaatgagatc
gaagaatcctgtctgaagaagcacagagacgcctggcgggagtactgtcgacgagtgcca
tacaaactgctgccttgcgtgtactga

DBGET integrated database retrieval system