KEGG   Sinocyclocheilus rhinocerous: 107757795
Entry
107757795         CDS       T04916                                 

Definition
(RefSeq) aryl hydrocarbon receptor protein 1-like isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
srx  Sinocyclocheilus rhinocerous
Brite
KEGG Orthology (KO) [BR:srx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:srx03000]
    107757795
Transcription factors [BR:srx03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107757795
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3
Other DBs
NCBI-GeneID: 107757795
NCBI-ProteinID: XP_016430856
Position
Unknown
AA seq 582 aa
MIPPGDCLYAGRKRRKPVQKEKPEKAGQKSNPSKRHRDRLNAELDRLASLLPFSADVISK
LDKLSVLRLSVSFLRVKSFFQAVQEKENRSSDTSTSEQKKEILPRVIEGDLLLKSLPGFA
LIVSSDGVIFYASCTIVDYLGFHQTDVMHQKVFDYIHVEERQEFHRQLHWAMNPGQQDTV
DEDAVMGHLYSSEEPDGVPPKLSPFLTRCFVARVRCLLDSTSGFLNMQFQGSLKILQGQK
RKTDSGALLPPQLALFCVAVPLVLPSIMELKMKSMMMKSKHHRSGSSDKWQQVSHGSFDC
EDMQCLNWTSTSGHDGSCSAMANRKYRGEGCKTQDEPLNFCVSTLGISRLQAVDPSWDAH
CPVALRTGPSENYLPGSFYKHSHSGKLRIGCNPESQKLESYCINRKAERRYTQNECFNVI
PETAIKTEESDSENGCNAYGSLWRPEYAQVKTEAEYYDCFTSYQRGKAVISPPINGHHKY
LCAGVSRPLKCVLNKDMNHSDAPISSQDGYVFSNDHKSCMQHDIRLTCEFKSHNLLHTVK
QEPDNSPPWCADVSQGNVQQRITSNCTMNTVLHKANPYVYMQ
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgattccgcctggagactgtctgtacgccggaaggaaaaggagaaaacctgtgcagaaa
gagaaaccagagaaagcaggtcagaaatcgaatccatccaagcgtcatcgcgaccgtctg
aatgcagaactggacaggttagcgagtctgctgcccttcagtgcagatgtcatctccaaa
ctggacaaactctcagtgctgaggctcagcgtcagcttcctgcgagtgaagagcttcttt
caagcagtccaagagaaagaaaatcgcagcagtgatacctcgacctcggagcagaagaaa
gaaatcctgccccgtgtcatagagggggatcttctcctaaagtcgctccctggatttgca
ctgatcgtgagctcggatggagttattttctatgcatcatgcactatcgttgactacctg
ggatttcatcagacggacgtgatgcatcagaaggtctttgattatatccatgtggaggag
cgacaggagtttcacaggcagctccattgggcgatgaaccctggccagcaagacactgtt
gatgaggatgctgtgatgggtcatctgtatagctctgaagagcctgacggcgttcctcct
aaattgtctccattcctcactcggtgcttcgtcgctcgagtccgctgcctgctggacagc
acctctggcttcctgaacatgcagtttcagggcagcctgaagatcctgcagggtcagaag
aggaagacagactctggagcgctgctgccgcctcagcttgccctgttctgtgtggctgtt
cctctagtcctaccatccatcatggagctcaagatgaagagtatgatgatgaaaagcaaa
caccataggtctggcagcagtgataagtggcagcaggtttcccatggctcatttgactgt
gaagacatgcagtgtcttaactggacaagcacatccggtcatgatggttcgtgttcagcc
atggccaacaggaagtacagaggagagggctgcaaaacccaagacgaacctctcaacttc
tgtgtttctactctgggcatctctagattgcaggctgttgatccttcctgggacgcccac
tgtcctgttgccttacgcacggggcccagtgaaaactacctgcctggaagcttctataag
cacagccattctggaaaattacgaatcgggtgtaacccagaatcgcagaagcttgagagt
tattgcatcaaccggaaggctgagagaaggtacacgcagaatgaatgttttaacgtgatt
cctgaaacggccattaagactgaagagtcagactctgagaatgggtgtaatgcatacggg
tcgctttggcgccctgaatatgcacaggtgaaaaccgaggctgaatattatgactgtttt
acttcatatcaaaggggcaaagctgtcatcagtcctcccatcaacggacaccacaagtat
ctgtgtgcaggagtcagcagacctcttaagtgcgtcctgaacaaagacatgaatcactct
gacgctcctatcagcagtcaggacggatatgtgttttcaaatgatcataaaagctgcatg
cagcatgatatccggctgacttgtgagttcaagagtcataaccttctgcacacggtcaaa
caagaacctgacaactctccaccttggtgtgctgatgttagtcaagggaatgtgcaacaa
cgtattacttcaaattgcactatgaacactgttctacacaaagcaaacccgtatgtttac
atgcagtaa

DBGET integrated database retrieval system