KEGG   Serratia plymuthica S13: M621_10480Help
Entry
M621_10480        CDS       T02716                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sry  Serratia plymuthica S13
Pathway
sry00052  Galactose metabolism
sry00500  Starch and sucrose metabolism
sry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    M621_10480
   00500 Starch and sucrose metabolism
    M621_10480
Enzymes [BR:sry01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     M621_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGP44174
UniProt: S4YHH2
Position
complement(2176465..2177907)
Genome map
AA seq 480 aa AA seqDB search
MNNALAQADHAVETLRAQRQDDYYPRFHLAPAAGWINDPNGLVYINGVYHAFYQHHPYDE
NWGPMHWGHAISRDLAHWQHQPIALAPGDDYDKDGCFSGCAVDDNGVLTLIYTGHVWLDK
VGDDDQVREVQCLATSEDGVHFVKHGPVLAPPEGIQHFRDPKVWRENDGWWMVVGAKQNG
LGQARLYRSKDLRDWQFDRVLDGAQTLHQGYMWECPDFFPLGEKQVLLFSPQGLAAQGYR
HRNRFQSGYLLGHWQPGADFNVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHGWAGALTLPRELTLNAEGDVLMNPARELAALRGLPQRFAAAQLRNQRQLLAENL
QELTLSLDLAASDAERYGIAIGDAARLYVDNQAHRLVLERFSEEPGLCGCRSVPLPAGDT
LSLNLFIDRSSLEVFVNQGVACLTSRIYPTDGQRGVSLFAESGQAQFEALQGWELASIWA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgccttagctcaagccgaccatgcggtcgaaaccctgcgcgcacagcgtcag
gacgattactacccgcggtttcatctggcgcctgccgccggctggatcaacgatcccaat
gggctggtgtacattaacggcgtttatcatgcgttctatcagcatcacccctacgacgaa
aactgggggccgatgcactggggccatgccatcagccgggatctggcgcactggcagcac
cagccgatagccctggcgcccggcgacgactacgacaaagacggctgtttctccggctgc
gcagtggacgataacggcgtgctgacgctgatctacaccggccacgtctggttggacaaa
gttggcgatgacgatcaggtgcgcgaggttcagtgcctggccaccagcgaggacggcgta
catttcgtcaaacacggaccggtgctggcaccgccggaagggattcagcatttccgcgat
cccaaggtctggcgcgagaatgacggctggtggatggtggtcggcgccaaacaaaacgga
ctcgggcaggcacggctttatcgttcaaaagatctgcgtgactggcagtttgaccgcgtg
ctggacggcgcgcagacgttgcatcagggctatatgtgggagtgcccggatttcttcccg
ctcggcgaaaaacaggtgctgctgttctcgccgcaggggctggcggcgcaggggtaccgc
caccgtaaccgcttccagagcggctatttgctcggtcactggcagccgggcgccgatttc
aacgtcactcaacctttctgcgagctggacgccgggcatgatttctatgcgccgcaaact
ttcaccgccgccgacggccgccgcctgctgttcgcctggatggacatgtgggaatcgccg
atgccgagcaaggcgcacggttgggccggtgcgctcaccctgccccgcgaactgacgctg
aatgccgaaggcgatgtgctgatgaacccggcgcgggagttggcggcgctgcgcggcctg
ccgcagaggtttgccgcagcgcaactgcgcaaccaacgccagcttctggcggaaaacctg
caagagctgacgctgtcgttggatctggccgccagcgatgccgaacgctacggtatcgcc
attggcgacgccgcccggctgtacgtggacaaccaggcccacaggctggtgttggagcgt
ttcagcgaggagccgggtctgtgcggttgccgcagcgtgccgctgccggcgggcgacacg
ctgtcgctgaacctgtttatcgaccgttcatcgctggaagtgttcgtcaatcagggcgtt
gcctgcctgaccagccgcatctacccgaccgatggccagcgcggcgtgagcctgtttgcc
gaaagcggccaggcacagtttgaagcgttacaggggtgggaactggcgagcatctgggcc
tga

DBGET integrated database retrieval system