KEGG   Serratia plymuthica S13: M621_10495Help
Entry
M621_10495        CDS       T02716                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sry  Serratia plymuthica S13
Pathway
sry00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M621_10495
Enzymes [BR:sry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     M621_10495
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     M621_10495
    1.1.1.-  
     M621_10495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AGP46975
UniProt: S4YS16
Position
complement(2180152..2181141)
Genome map
AA seq 329 aa AA seqDB search
MKAARFYGVGDLRIEDIAPPSALPDDAVRVRVLAAGICGSDLHNFRTGQWIGPLPVTPGH
EFCGEVLAIGSAVSRFAVGDRVVADSRVGCGHCAACQSGRHNLCRSLGFVGEVCDGGFAE
QVQLPASRLLRVPDTLPAAIAALSEPLGVALRVVNQLNPPPGEPVLIAGGGTIGGLVALL
LHHLRGCPLLVAESNPLRLTVLSQVLPLQAVELDHDLPLAAAYAVEATGVTGVLNQLINL
VTPGGRIAMVGLFHGQAAIDANRLVEREISLIGCSVFADEQRSAISLLPQLAGELAHWIS
RPIPLDALPDTYRQLLAGRVGALKTLVVP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcacgtttttatggcgtaggcgacctgcgcatcgaagacatcgccccgccg
tccgccctgcccgacgatgcggtacgcgtgcgggtgctggccgccggtatttgcggttcc
gacctgcataacttccgcaccgggcaatggatcggtcctctgccggtcacccccggtcat
gagttctgcggtgaagtgttggcgatcggcagcgcagtaagccgctttgccgttggcgac
cgggtggtggccgactcacgcgtcggttgcggccactgtgccgcctgccaaagcgggcgt
cacaacctgtgccgttcgctgggttttgtcggcgaagtctgcgacggcggctttgccgaa
caagtgcagttgccggcctcacggctgctgcgggtaccggataccctgccggcggcgatt
gccgccctgagcgagccgcttggcgtggcactgcgggtggtgaatcagttgaacccgccc
cccggagaaccggtgttgatcgccggtggcggcaccataggcgggttggtcgccttgtta
ttgcaccatctgcgcggctgcccgttgctggtggcggagtccaacccgctgcggctgaca
gtgctcagccaggtgctgccgctacaggcggtggagctggatcacgacttaccgctggcg
gcagcctacgcggtggaggccaccggcgttaccggagtattgaatcaactgattaacctc
gtcaccccaggcggccgcattgccatggtcggtctgtttcatgggcaggcggcaatcgat
gccaataggctggtggagcgcgagatttcgctaatcggttgcagcgtgttcgccgatgag
caacgcagcgccatcagcctgttgccgcagttggccggcgaactggcgcactggatatcc
cggccgatccctctcgacgccctgccggatacctatcggcaattgttggcggggcgcgtc
ggagcgctgaaaaccctggtggttccctga

DBGET integrated database retrieval system