KEGG   Serratia plymuthica S13: M621_15990Help
Entry
M621_15990        CDS       T02716                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sry  Serratia plymuthica S13
Pathway
sry00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M621_15990
Enzymes [BR:sry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     M621_15990
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     M621_15990
    1.1.1.-  
     M621_15990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 Shikimate_DH F420_oxidored 2-Hacid_dh_C NTP_transf_3 ApbA Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: AGP45116
UniProt: S4YKT0
Position
3346443..3347570
Genome map
AA seq 375 aa AA seqDB search
MSLCLGHRHIGHRGRFTVNFKGKMMKAARWYQARDIRIDDIEEPQVSAGKVKIKVAWTGI
CGSDLHEYLAGPIFAPVGKPHKLSHDIAPIVMGHEFSGEVVDVGRGVTKFKAGDRVVVEP
ILACRQCEACREGKYNLCADLGFHGLSGGGGGFSSFTMVDEHMVHRMPDALSYEQGALVE
PAAVALHAVRMSKLKAGDKAAVFGAGPIGLLVIEALRAAGAAEIYVVELSPQRAEKAREL
GAKVVIDPSKDDAVATIRELSAGGVDVAFEVTGVPVVLKQCIDSTRYEGETIIVSIWEGE
AAFHPNKVVLSERSVKGIIAYRHIFPAVMDLMTQGYFQADKLVTKRIELADLVEQGFEAL
VKEKQQVKILVRPPQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgagtctctgcctcggccaccgacatatcggccaccgaggcaggtttacggttaatttc
aaggggaagatgatgaaagcagctcgttggtatcaggcgcgcgacatccgtattgatgat
attgaagaacctcaggtttccgccggtaaggtgaaaatcaaggtagcctggaccggaatt
tgcggcagcgacctgcacgaatacctcgccggaccgatttttgccccggtaggcaaacct
cacaagctaagccatgacatcgcgcctatcgtcatgggccatgagttttccggtgaagtg
gtggacgtcggtcgcggcgtgacgaaattcaaagccggtgaccgcgtggtcgtagagccg
atcctggcttgtcggcagtgcgaagcctgccgcgaaggcaaatataacctgtgcgccgat
ctgggttttcacggtctgtccggcggtggcggcggcttctcctcctttaccatggtagac
gagcatatggtacaccgcatgcccgatgcgctcagctatgagcaaggtgcgttggtagaa
cctgcggcggtagcccttcatgcggtgcggatgagcaaattgaaagccggggataaagcg
gccgtcttcggtgccggccccatcggcctgctggtgattgaagcattgcgcgcagccggt
gcggcagaaatttatgtggtcgaactgtcacctcagcgggcagaaaaagcgcgcgaactg
ggggcgaaagtggttatcgaccccagcaaagacgatgccgtcgccacaatacgcgagctg
agcgcgggtggcgttgacgtggcgtttgaagtgaccggcgtgccggtggtgctaaaacag
tgcatcgacagcactcgctacgaaggcgagacgattatcgtctccatctgggaaggggaa
gcggcattccatccgaacaaagtggtgctcagcgaacgttcagtcaaagggattatcgct
tatcgccatattttcccggcggtgatggatctgatgacccagggctacttccaggccgac
aagctggtgaccaagcgtatcgaactggctgatttggtggagcagggttttgaagcgctg
gtgaaagaaaaacaacaggttaaaatcctggtgcgtccaccgcagtaa

DBGET integrated database retrieval system