KEGG   Serratia plymuthica S13: M621_20955Help
Entry
M621_20955        CDS       T02716                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sry  Serratia plymuthica S13
Pathway
sry00010  Glycolysis / Gluconeogenesis
sry00030  Pentose phosphate pathway
sry00051  Fructose and mannose metabolism
sry00680  Methane metabolism
sry01100  Metabolic pathways
sry01110  Biosynthesis of secondary metabolites
sry01120  Microbial metabolism in diverse environments
sry01130  Biosynthesis of antibiotics
sry01200  Carbon metabolism
sry01230  Biosynthesis of amino acids
Module
sry_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sry_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M621_20955
   00030 Pentose phosphate pathway
    M621_20955
   00051 Fructose and mannose metabolism
    M621_20955
  09102 Energy metabolism
   00680 Methane metabolism
    M621_20955
Enzymes [BR:sry01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     M621_20955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase S-methyl_trans
Motif
Other DBs
NCBI-ProteinID: AGP45895
UniProt: S4YN78
Position
complement(4416669..4417748)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFAVAKENNFALPAVNCVGTDSINAVLETAAKVRAPVIVQ
FSNGGAAFIAGKGVKTDVPQGAAILGAISGAHHVHQLAEHYGVPVILHTDHCAKKLLPWL
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSKYLTRMAKLGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVAYAYEKLNAISPRFTIAASFGNVHGVYKPGNVKLTPT
ILRDSQDYVSKKFNLPHNSLNFVFHGGSGSTDAEIKESVGYGVIKMNIDTDTQWATWDGI
LQYYKANEAYLQGQLGNPKGADQPNKKYYDPRVWLRAAQTSMITRLEQAFKDLNAVDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatttttgatttcgtaaaaccgggtgtcatcactggtgatgacgttcagaaa
gtattcgcagtagctaaagagaacaactttgcgctgccagcagtgaactgcgtgggtacc
gactccatcaacgccgtgctggaaacagccgcgaaggtacgtgctccggttatcgttcag
ttctccaacggcggtgccgcgtttatcgccggcaaaggcgtgaagactgacgttccgcag
ggcgcagcgattctgggcgcgatttctggtgcacatcatgttcaccagttggctgagcat
tacggcgtgccggttattctgcacaccgaccactgtgcgaagaaactgctgccatggctg
gacggcctgctggacgccggcgagaagcacttcgccgctaccggcaaaccactgttctct
tctcacatgatcgacctgtccgaagagtctctggaagaaaacatcgagatttgcagcaag
tacctgactcgcatggcgaagctgggtatgactctggaaatcgaactgggctgcaccggc
ggtgaagaagatggcgtggacaacagccatatggacgcatctgctctgtacacccaaccg
gaagacgtggcttacgcgtacgaaaaactgaacgccatcagcccacgcttcaccatcgcg
gcgtccttcggtaacgtgcacggcgtgtacaagccaggcaacgttaaactgaccccgacc
atcctgcgcgattctcaggactacgtgtccaagaaattcaacctgccgcacaacagcctg
aacttcgtgttccacggcggctccggttctaccgacgcagagatcaaagagtccgtaggc
tacggcgtgatcaaaatgaacatcgataccgacacccaatgggcaacctgggacggtatc
ctgcagtactacaaagcgaacgaagcttacctgcagggccagttgggcaacccgaaaggc
gctgaccagccgaacaagaaatactacgatccgcgcgtatggctgcgtgcagcccagact
tcgatgattactcgtctggaacaggctttcaaagacctgaacgcagtagacgttctgtaa

DBGET integrated database retrieval system