KEGG   Serratia plymuthica S13: M621_24090Help
Entry
M621_24090        CDS       T02716                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
sry  Serratia plymuthica S13
Pathway
sry02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sry00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M621_24090 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sry02022]
    M621_24090 (ompR)
Two-component system [BR:sry02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   M621_24090 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AGP46404
UniProt: S4YNU9
Position
complement(5108358..5109077)
Genome map
AA seq 239 aa AA seqDB search
MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaatcataagattctggtcgtcgatgatgacatgcgcctgcgtgcgctttta
gagcgttatttaaccgaacagggttttcaggttcgcagcgtcgccaacgctgagcaaatg
gatcgcttgctgactcgtgaatctttccacctgatggtgttggacctgatgttgccgggt
gaagatgggctgtccatctgccgccgtctgcgtagccagagcaacccgatgccgatcatc
atggtgaccgccaaaggcgaagaagtcgaccgtatcgttgggctggaaatcggcgccgac
gactacatcccaaaacctttcaacccgcgtgaactgctggcccgcatccgtgcggtattg
cgccgccaggccaacgaactgccaggcgccccttcgcaggaagaagcggtgattgccttc
ggcaaattcaaactgaatctgggcacccgtgaaatgttccgcgaagatgagcctatgcca
ttgaccagcggtgagtttgcggtgctgaaggcgttggtgagccacccgcgtgaaccgctt
tcgcgcgacaagctgatgaacctggcgcgcggccgtgaatacagcgcgatggaacgctcc
atcgacgtgcaaatttcccgtcttcgccgcatggttgaagaagatccggcacatccacgc
tatatccagaccgtttggggtcttggctacgtcttcgtcccggacggcagcaaggcatga

DBGET integrated database retrieval system