KEGG   Serratia rubidaea: AXX16_0594Help
Entry
AXX16_0594        CDS       T04417                                 

Definition
(GenBank) Alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
srz  Serratia rubidaea
Pathway
srz00010  Glycolysis / Gluconeogenesis
srz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AXX16_0594
Enzymes [BR:srz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     AXX16_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like SHOCT Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-ProteinID: AML56329
UniProt: A0A126VF96
Position
646340..646930
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSNLSGTPLAVLAERFSMGEVFQRHERGEVSDEEFAAR
LCDEMGIALSFEQFAAGWQAVFVALRPEVIAIMQRLRNEGHRVVVLSNTNRLHCNYWPQH
YPEVAAAADHLYLSQDLGLRKPEPAIYQRVLEAENTPAEQAVFFDDHPDNIAAARALGMT
AVWVTDRDTVPAYFAA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttaggtaacgtgatcgtcgatatcgatttcaaacgtgtgctg
ggcgtatggagcaatctgagcggcacgccgctggcggtgctggcggaacgctttagcatg
ggtgaggtatttcagcgccatgagcggggggaagtgagcgacgaggagttcgccgcccgt
ctgtgcgatgaaatgggcatcgcgctgagctttgagcagtttgccgccggctggcaggcg
gtatttgtcgcgctgcgtccggaggtgatcgccatcatgcagcgcctgcgcaacgagggc
caccgggtggtggtgctgtcgaacaccaaccgactgcactgcaattactggccgcagcac
tacccggaggtggcggcggcggcggaccatctctacctgtcgcaggatctcggcctgcgt
aaaccggagccggccatttaccagcgggtgctggaagcggaaaacaccccggcggaacag
gcggtattctttgacgatcatcccgataatattgcggccgcacgggctttgggcatgacg
gcggtatgggtgaccgatcgcgatacggtgccggcctattttgccgcttga

DBGET integrated database retrieval system