KEGG   Serratia rubidaea: AXX16_0681Help
Entry
AXX16_0681        CDS       T04417                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
srz  Serratia rubidaea
Pathway
srz00670  One carbon pool by folate
srz01100  Metabolic pathways
srz01120  Microbial metabolism in diverse environments
srz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AXX16_0681
Enzymes [BR:srz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AXX16_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AML56416
Position
739365..740261
Genome map
AA seq 298 aa AA seqDB search
MSFFHANQREALNQSLAELNGQINVSFEFFPPRTSEMEETLWQSIDRLSSLKPKFLSVTY
GANSGERDRTHGVIKGIKDRTGLEAAPHLTCIDASREQLSEIARDYWNNGIRHIVALRGD
LPPNSGKPEMYAADLVALLKEVGDFDISVAAYPEVHPEAKSAQADLINLKRKIDAGASRA
ITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQRFAAMTNVRVPSWMTSMFA
GLDDDPETRKMVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPVAAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttttcacgcaaaccagcgggaagcgctgaaccagagcctggccgaattaaac
ggtcagattaacgtatcgtttgagttctttccgccgcgcaccagcgaaatggaagagact
ctgtggcagtcgatcgatcgtctgagtagcctgaagcccaaattcctctcggtcacctac
ggcgccaactccggcgaacgcgatcgcacccacggcgtcatcaaggggattaaggatcgc
accggccttgaggccgctccgcacctgacctgcattgacgcctcgcgcgaacagctgagc
gagatcgcccgcgactactggaacaacggcattcggcatatcgtggcgctgcgcggcgat
ctgccgccgaacagcggcaaaccggagatgtacgcggccgatttggtggcgctgctgaag
gaggtgggtgatttcgatatttcggtggcggcgtacccggaggtgcacccggaggcgaaa
agcgcgcaggccgatctgatcaacctgaagcgtaaaatcgatgccggcgccagccgcgcg
attacccagttcttctttgacgtggaaagctacctgcgttttcgcgaccgctgcgtcgcc
accggcattgacgttgaaatcgtgccgggcattctgccggtgtccaacttcaagcagctg
cagcgcttcgccgccatgaccaacgtgcgggtgccgagctggatgaccagcatgttcgcc
gggctggatgatgacccggaaacgcgcaaaatggtgggggccaatattgccatggatatg
gtgaagatcctcagccgtgaaggggtaaaagacttccacttctacacgctgaaccgcgcc
gagatgagctacgcaatttgccatacgttgggagtgcgcccggtagcggcggcatga

DBGET integrated database retrieval system