KEGG   Serratia rubidaea: AXX16_0914Help
Entry
AXX16_0914        CDS       T04417                                 

Definition
(GenBank) Homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
srz  Serratia rubidaea
Pathway
srz00270  Cysteine and methionine metabolism
srz00920  Sulfur metabolism
srz01100  Metabolic pathways
srz01110  Biosynthesis of secondary metabolites
srz01130  Biosynthesis of antibiotics
srz01230  Biosynthesis of amino acids
Module
srz_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AXX16_0914
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AXX16_0914
Enzymes [BR:srz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AXX16_0914
    2.3.1.46  homoserine O-succinyltransferase
     AXX16_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AML56636
UniProt: A0A126VFK3
Position
972103..973032
Genome map
AA seq 309 aa AA seqDB search
MPIRVPDELPAVCFLRNENVFVMTSSRAKTQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQIDIQLLRIDSRESKNTPAEHLNNFYCNFEDIQHDNYDGLIVTGAPLGLVDFSDVAY
WPQIERIIDWAKEHVTSTLFVCWAVQAALNILYGIPKMTLDEKLSGVYQHQTLQQHALLT
RGFDETFLAPHSRYADFPTEIIRQYTDLDILAESEQAGAYLFASKDKRLAFVTGHPEYDA
QTLAGEYCRDYDAGLNPRVPLNYFPDDNPDLPPKASWRSHGHLLFSNWLNYYVYQITPFD
LRHMNPTLE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcgtgttcctgatgagttacctgcagtctgtttcttgcgtaatgagaatgtc
tttgtgatgacatcctcacgggcaaagacgcaggaaatcaggccgttaaaggtgctgatc
cttaacctgatgccaaagaaaatagagacggaaaaccagttcctgcgtttactgtccaac
tcaccgctgcagattgatattcaactgctgcgcatcgacagccgcgaatctaaaaatacg
ccggccgagcacctgaataacttctactgcaactttgaagatatccagcacgataattac
gatggcctgattgttaccggcgcgccgttggggctggtcgacttcagcgacgttgcctat
tggccgcagatcgaacgcattatcgactgggcgaaagaacacgtgacctcaacgctattt
gtctgttgggcggtacaggcggcattgaatatcctgtatggcatcccgaagatgacgctc
gacgagaagctgtcgggggtatatcagcatcagacactgcaacagcatgcattgctgacc
cgaggttttgatgaaactttcctggcgccgcattcacgctatgcggatttcccgacggag
attatccgccagtacaccgaccttgatattctggccgaatccgagcaggccggcgcttac
ctgtttgccagcaaggacaagcgcctggcctttgtgacgggacacccggagtatgatgcg
cagacgttggcgggagagtattgtcgtgattacgatgccggccttaaccctcgcgtaccc
ctcaattacttccccgatgataaccctgatttaccgccaaaagcctcctggcgcagtcac
ggacacctgctgttctccaattggctgaactattacgtctaccagattacgccgtttgat
ctgcgccacatgaaccctacgctcgaatag

DBGET integrated database retrieval system