KEGG   Serratia rubidaea: AXX16_1175Help
Entry
AXX16_1175        CDS       T04417                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
srz  Serratia rubidaea
Pathway
srz00052  Galactose metabolism
srz00500  Starch and sucrose metabolism
srz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AXX16_1175
   00500 Starch and sucrose metabolism
    AXX16_1175
Enzymes [BR:srz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AXX16_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AML56896
UniProt: A0A126VGA5
Position
complement(1267058..1268467)
Genome map
AA seq 469 aa AA seqDB search
MDALSLMKHTALALMQGQTRAAADPHRPLWHLAPSVGLLNDPNGFIQHNGVYHLFYQWNP
LACDHGRKCWGHWQSRDLLHWQHQPVALLPDARYDSHGCYSGSAVAADGKIMLVYTGNVK
YPDGSRTAYQCLAQEDERGEYRKLGPVLPLPDGYSGHVRDPKVWRHEQSWYMVLGARDLQ
DRGKVLLLRSANLRQWTLLGEIAGAHLNGLGDFGYMWECPDLFRLAGREVLICCPQGLAA
QPERYLNVYQAGYFVGELDYPAARFSHGDFHELDAGFEFYAPQTTLAEDGRRLLVGWMGV
PEQDEQLQPTTRYGWLHTMTCLRELTLRDGRLYQQPVAELQQLRGDLTRWQGAADNAPPL
ALGSAELWLTPHGPFRAGFGDAMQLTWDGERLTLTRTNLRSGAAEHRYWRGDLRELQLLF
DRSSVEIFINRGAAVMSSRYFPAAPPDLRLHGAAPLALQYWPLRPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgctgagcctgatgaaacacaccgcgctggcgctgatgcagggccagacgcgc
gccgccgccgatcctcaccgcccgctgtggcacctggcgcccagcgtcgggctgctcaac
gatcccaacgggtttattcagcacaacggcgtgtaccatctgttctatcagtggaacccg
ctggcctgcgaccacggccgcaaatgctggggccactggcagtcccgcgatctgctgcac
tggcagcaccagccggtggcgctgctgcccgacgcccgctacgacagccacggctgctat
tccggctcggcagtggcggcggacggcaagatcatgctggtctataccggcaatgtgaaa
taccccgacggttcgcgcaccgcctaccaatgtctggcgcaggaggatgagcgcggcgaa
taccgcaagctcggcccggtgctgccgctgcccgacggctacagcggccacgtgcgcgac
ccgaaggtctggcgccatgagcagagctggtacatggtgctgggcgcgcgcgacctgcag
gatcgcggcaaggtgctgctgctgcgctccgctaacctgcgtcagtggacactactggga
gagatcgcgggcgcgcacctgaacggcctgggcgacttcggctatatgtgggagtgccca
gacctgttccgccttgccgggcgcgaagtgctgatttgctgcccgcaggggctggcggcg
cagccggagcgctatctcaacgtctatcaggccggttatttcgtcggcgagctggattac
ccggcggcacgcttcagccacggtgactttcacgagctggatgccggcttcgagttttat
gcgccgcaaaccacgctggcggaagatggccgacgactgctggtgggctggatgggggtg
ccggaacaggacgaacagctgcagccgacgacgcgctacggctggctgcacaccatgacc
tgcctgcgcgagctgacgctgcgcgacggccggctgtatcagcagccggtcgccgaactg
cagcagctgcgcggggatctgacccgctggcagggagcggccgacaacgcgccgccgctg
gcgctcggcagcgccgaactgtggttaacgccgcacggcccgttccgcgccggcttcggc
gacgccatgcagctgacctgggacggcgaacggctgacgctgacgcgcactaacctgcgc
agcggcgcggcggagcaccgctactggcgcggcgatctccgggagctgcagctgctgttt
gaccgctccagcgtggagatctttatcaaccgcggcgccgcggtgatgagctcgcgctac
ttccctgccgcgccgccagacctgcggctgcacggcgccgcgccgctggcgctgcaatac
tggccgctgcggccatgcatgttagaataa

DBGET integrated database retrieval system