KEGG   Serratia rubidaea: AXX16_2708Help
Entry
AXX16_2708        CDS       T04417                                 

Definition
(GenBank) metal-dependent phosphoesterase (PHP family)
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
srz  Serratia rubidaea
Brite
KEGG Orthology (KO) [BR:srz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXX16_2708
Enzymes [BR:srz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     AXX16_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AML58405
Position
2912923..2913798
Genome map
AA seq 291 aa AA seqDB search
MTDSTSPSSAFTLYDLHSHTTASDGSCTPAQLVQRAAEMRVGVLAITDHDTTDGLAAAAA
AIAQHALPLQLVNGVEISTLWENHEIHIVGLGIEPAHPAMVQLLAEQIARRQQRAQEIGV
RLAKARIDGAFEGAQRLADGGAVTRGHFARYLVEVGAADNIGQVFKKYLAKGKTGYVPPR
WCTIEQAIDVIHQSGGQAVVAHPGRYDLTAKWLKRLLAYFAEHGGDAMEVAQCQQAPNER
TQLAQYARDFQLLASQGSDFHQPCSWIELGRKLWLPAGVEPVWRDWPPARQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgactgacagcacatcgccatcctccgcctttaccctgtacgatcttcatagccatacc
accgcctcagacggttcctgcacgccagcgcagctggtgcagcgggcggcggagatgcgc
gtcggggtactggcgattaccgaccacgacaccaccgacgggctggcggcggctgcggcg
gctattgcccagcatgcgctgccgctgcagctggtcaacggcgtggagatctccaccctg
tgggaaaatcacgagatccatatcgtcggtctgggcatcgaaccggcccatccggcgatg
gtgcagctgttggctgagcagattgcacggcgccagcagcgcgcgcaggagatcggcgta
cgtctggccaaggcgcgtattgacggcgccttcgaaggcgcgcagcggctggccgacggc
ggggcggtgacgcgcggacactttgcccgctatctggtggaggtcggcgccgctgacaat
atcggccaggtgtttaaaaagtatctggccaaggggaaaaccggctacgttccgccacgg
tggtgtacaatagaacaagctattgatgtgattcatcaatccggcggacaggcggtggtc
gcccaccccggccgttatgatttaacggcgaaatggctaaaacgcctgctggcgtatttt
gccgagcatggtggtgatgcgatggaggtcgcacagtgtcagcaggcgccgaacgaacgc
acgcagctggcgcagtacgcccgggattttcagctgttggcgtcgcagggctcggatttt
caccaaccctgctcgtggattgaactggggcgcaagctgtggttgcccgccggcgttgag
ccggtgtggcgcgactggccgccggcgcggcaatga

DBGET integrated database retrieval system