KEGG   Serratia rubidaea: AXX16_3127Help
Entry
AXX16_3127        CDS       T04417                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
srz  Serratia rubidaea
Pathway
srz00480  Glutathione metabolism
srz00590  Arachidonic acid metabolism
srz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AXX16_3127
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AXX16_3127
Enzymes [BR:srz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AXX16_3127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: AML58823
Position
3372075..3372560
Genome map
AA seq 161 aa AA seqDB search
MLPSLLSIPCTTLQGEAKTLGDFPARAYLVVNTASKCGFTPQYRGLENLWRYYRDRGLVV
MGFPCNQFGAQEPGDAQEIASFCSLNYGVSFPLFAKIMVNGPDAHPLFNELKRRAPGLLG
SQRIKWNFTKFLLTADGQRVTRFAPLTKPERLFERIETLLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgctcccatcgctgttatccattccctgcaccaccctacagggcgaagccaaaaccctg
ggtgacttcccggcgcgcgcctatctggtggtgaacaccgccagcaaatgcggctttacc
ccgcaataccgcgggctggaaaatctgtggcgctactatcgcgaccgcggtctggtggtg
atgggctttccctgcaaccagttcggcgcgcaggagccgggcgacgcgcaggagatcgcc
agcttctgcagcctcaactacggcgtcagttttccgctgtttgccaagattatggtcaac
gggccggatgcgcatccgctgtttaacgagctgaagcgccgcgcgcccgggctgttgggc
agccagcgcatcaaatggaacttcaccaaattcctgcttaccgccgacggccagcgcgtc
acgcgctttgcgccgctgaccaagccggagcgcctgttcgagcgtattgagacgctgctg
aaataa

DBGET integrated database retrieval system