KEGG   Serratia rubidaea: AXX16_3221Help
Entry
AXX16_3221        CDS       T04417                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
srz  Serratia rubidaea
Pathway
srz00052  Galactose metabolism
srz00500  Starch and sucrose metabolism
srz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AXX16_3221
   00500 Starch and sucrose metabolism
    AXX16_3221
Enzymes [BR:srz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AXX16_3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AML58917
UniProt: A0A126VL40
Position
3465918..3467360
Genome map
AA seq 480 aa AA seqDB search
MKELLAQADHAVEKLRAARQDDLYPRFHLAAQAGWINDPNGLICIDGVYHAFYQHHPFDE
HWGPMHWGHATSRDLVHWQHQPIALAPGDADDRDGCFSGCAVDDQGVLTLLYTGHVWLGE
PGDDSQLREVQCLATSEDGIHFTKHGAVLTPPEGIMHFRDPKVWQQDGQWWMVIGAKEHD
LGQVRLYRSDDLRNWRFERVLAAAEHARQGYMWECPDFFPLGERQLLVFSPQGLAAQGYR
YRNRFQSGYLLGNWQPDGAFTVTQPFSELDAGHDFYAPQTFTAADGRRLLFGWMDMWESP
MPSKAHGWAGALTLPRELSLGADGQLRMQPARELTALRGAVRQFDAVRCRNQRLPLEDEL
HELQLTLDTADSDAERYGISLGGAARLYVDNQAHRLVLERFSDDPALCGCRSVPLPAGVS
LQLRLFIDRSSLEVFVNDGEACLTSRIYPQDGDRRLSLFAEGGAAYFSAIAGWTLDSIWR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacttttagcccaggccgaccacgccgtagaaaagctgcgcgccgcgcgtcag
gacgacctgtacccgcgtttccacctggccgcgcaggccggctggattaacgaccccaac
ggactgatttgcatcgacggggtgtaccacgcgttttatcagcaccaccccttcgatgag
cactgggggccgatgcactgggggcacgccaccagccgcgatctggtgcactggcagcat
cagccgatcgcgctggcgcccggcgacgccgacgaccgcgacggctgtttctccggctgc
gcggtcgatgaccaaggcgtgctgacgctgctgtataccggccacgtctggctcggcgag
ccgggcgacgactcgcagctgcgcgaggtgcaatgtctggctaccagcgaggacggcatc
catttcaccaagcacggtgcggtactgacgccgccggaaggcattatgcacttccgcgat
ccgaaagtgtggcaacaggacgggcagtggtggatggtcatcggcgccaaagagcacgat
ctgggtcaggtgcggctgtaccgttccgacgatctgcgcaactggcgctttgaacgggtg
ctggccgccgccgagcacgcccggcagggctatatgtgggagtgcccggacttcttcccg
ctgggggaacgccagctgctggtcttttcgccgcaggggctggcggcgcagggttaccgc
tatcgcaaccgcttccagagcggctacctgctcggcaactggcagccggacggcgcattc
acggtcacccagccgtttagcgagctggacgccggacatgatttttacgcgccgcagacc
ttcaccgccgccgatggccgtcgcctgctgttcggctggatggatatgtgggagtcgccg
atgcccagcaaggcgcacggctgggccggcgcgctgacgctgccgcgtgaactgtcgctc
ggtgccgacggccagctgcgtatgcagccggcgcgcgaactgacggcgctgcgcggcgcc
gtacgccagtttgacgccgtgcgctgccgcaaccagcggctgccgctggaggatgagctg
cacgaactgcagctgacgctggatacggccgacagcgacgccgaacgctacggcatcagc
ctgggcggcgcggcgcggctgtatgtggataatcaggcgcaccggctggtgcttgagcgg
ttcagcgacgatccggcgctgtgcggttgccgcagcgtgccgctgcccgccggcgtatct
ttgcagctgcggttgtttatcgatcgttcttcgctggaggtgttcgtcaacgacggcgag
gcctgcctgaccagccgcatctacccgcaggacggcgaccgccggctgagcctgtttgcc
gaaggcggcgcggcgtacttcagcgcgatcgccggctggacgctggacagcatctggcgc
taa

DBGET integrated database retrieval system