KEGG   Serratia rubidaea: AXX16_4126Help
Entry
AXX16_4126        CDS       T04417                                 

Definition
(GenBank) Gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
srz  Serratia rubidaea
Pathway
srz00430  Taurine and hypotaurine metabolism
srz00460  Cyanoamino acid metabolism
srz00480  Glutathione metabolism
srz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AXX16_4126
   00460 Cyanoamino acid metabolism
    AXX16_4126
   00480 Glutathione metabolism
    AXX16_4126
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:srz01002]
    AXX16_4126
Enzymes [BR:srz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     AXX16_4126
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     AXX16_4126
Peptidases and inhibitors [BR:srz01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   AXX16_4126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept Sporozoite_P67
Motif
Other DBs
NCBI-ProteinID: AML59808
Position
4426864..4428627
Genome map
AA seq 587 aa AA seqDB search
MLLNKLSKPLTMAALLVSGSLHAASSPAVEAQQGMVVTSQRLASQVGVDILKMGGNAVDA
AVAVGYAQAVVNPCCGNIGGGGFMTVHLADGTDTFINFRETAPAAASANMYLEADGKVKK
DASLYGYLAAGVPGTVLGMETARKKYGKLSREQVMAPAIKLAREGFVLTRADTDILDTTV
ARFKQDPEAARIFLRKDGSALQPGDRLVQSDLANTLEAIARQGPDAFYHGKIPQAVEAAA
RKGGGILTADDFANYKVTETAPITCSYRGYKFVSSPPPSSGGVTLCETLNILEGYDLKSM
GFNSAAAIHTMTEAMRHAYMDRNTYLGDPAFISNPIDRLVSKSYAEQIRKQIVPGKATPS
TNVQPGMEPHEKPETTHYSIVDHDGNAVSTTYTVNGRFGAVVIAPGTGFFLNDEMDDFTV
KVGEKNLYGLVQGTANAIAPGKRPLSSMSPTLVTKDNKIFMVLGSPGGSRIITITLQTAL
NVIDHGMAPQEAVDAPRIHHQWLPDEVYYEQRGVSADTLSLLQKMGYNMVEQTPWGAAEL
ILVGLPGAAGVAPANSGNDSAVSGKVREGYLYGANDVRRPAGAAIGY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgaataaattgagtaaacccctgaccatggcggcgctgttggtcagcggcagc
ctgcacgccgcctccagtccggcggtggaagcgcaacagggcatggtggtcacctcgcag
cgcctggcctcgcaggtgggcgtcgacatcctgaaaatgggcggcaatgcggtggatgcc
gcggtggccgtgggctatgcgcaggcggtggtcaacccctgctgcggcaatattggcggc
ggcggctttatgaccgtccacctggccgacggcaccgatacctttatcaacttccgtgaa
accgcgccggcggcggccagcgccaatatgtatctggaggccgacggcaaggtgaaaaaa
gacgccagcctgtacggctatctggccgccggcgtgccgggcaccgtactggggatggaa
accgcacgcaaaaaatatggcaagctgagccgtgagcaggtgatggcgccggccatcaag
ctggcgcgggaaggctttgtgctgacgcgcgccgataccgatatcctcgacaccaccgtg
gcgcgttttaaacaggatccggaagcggccagaatcttcctgcgcaaagacggcagcgcg
ctgcagccgggcgaccggctggttcagagcgacctggccaatacgctggaagctatcgcc
aggcaggggccggacgccttctaccacggcaaaattccgcaggcggtggaagcggcggcc
cgcaagggcggcggcattctgaccgccgatgacttcgccaactataaagtcaccgaaacg
gcgccgattacctgcagctaccgcggctataagttcgtctcatcgccgccgcccagctcc
ggcggcgttacgctgtgtgaaacgctgaatatcctggaaggttacgatctgaagagcatg
ggctttaactcggcggcggccatccacaccatgaccgaagccatgcgccacgcctatatg
gatcgcaacacctacctcggcgacccggcctttatcagcaacccgatcgaccggctggtc
agcaaaagctacgccgagcagatccgcaagcagattgttcccggcaaggcgacgccgtcg
accaacgtgcagccgggcatggagccgcatgaaaaaccggaaaccacccactactccatc
gtcgatcatgacggcaatgcggtctccaccacctacaccgtcaacggccgcttcggcgcg
gtggtgattgcccccggcaccggcttcttcctcaatgacgaaatggatgacttcaccgtg
aaggtcggcgagaaaaacctctacggcctggtgcagggcaccgccaacgccatcgccccc
ggtaagcgcccactatcgtcgatgagcccgacgctggtgaccaaagacaataaaatcttt
atggtgctcggctcgccgggcggctcacgcattatcaccatcacgctgcagaccgcgctt
aacgtcatcgaccacggcatggcgccgcaggaggcggtggatgcgccgcgtattcaccac
cagtggctgcctgacgaggtttattacgaacagcgcggcgtctctgccgatacgctgagc
ctgctgcagaagatgggctacaatatggtggagcagacgccgtggggcgcggccgagctg
attctggtcggtcttccgggcgcggcgggcgttgcgccggccaactccggcaatgattcg
gcggtctccggcaaggtgcgcgaaggttatctgtacggcgccaacgacgtacgccgtcct
gccggcgcggcaatcggctactga

DBGET integrated database retrieval system