KEGG   Streptococcus sanguinis: SSA_0338Help
Entry
SSA_0338          CDS       T00473                                 

Gene name
mvaS
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00280  Valine, leucine and isoleucine degradation
ssa00650  Butanoate metabolism
ssa00900  Terpenoid backbone biosynthesis
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SSA_0338 (mvaS)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SSA_0338 (mvaS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSA_0338 (mvaS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSA_0338 (mvaS)
Enzymes [BR:ssa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SSA_0338 (mvaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 4806115
NCBI-ProteinID: YP_001034345
UniProt: A3CKU0
Position
complement(332250..333428)
Genome map
AA seq 392 aa AA seqDB search
MTIGIDKIGFATSNYVLKLNDLAAARGTDPDKLSKGLLLKELSIAPLTEDIVTLGAAAAD
PILTAEDKEKIDMVIVATESGIDQSKAAAVFVHGLLGIQPFARSFEIKEACYGATAALDY
AKLHIEKHPDSKVLVLASDIAKYGINTPGEPTQGAGAISMLISSNPRILAFNDDNVAQTR
DVMDFWRPNYSTTPYVNGLYSTQQYLDSLKTTWAEYQKRHKLALKDFAAYCFHLPYPKLA
LKGLNKIMDKSLPQEQQDQLRKNFEASILYSQKVGNIYTGSLFLGLLSLLENSDNLKAGD
RIALFGYGSGAVSEIFSANLVEGYEKHLSQTRLEELDQRQALSIPNYERIFFEEAELDAE
GNASFSGYEEQSFALAEIAEHQRKYIKVEKSS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcggaatcgacaaaatcggttttgcgaccagtaattatgtcttaaaattaaat
gatttagcggcagcccgtgggactgacccagacaagcttagcaaggggctcttactcaag
gaactaagcattgctcctctgactgaggatattgttaccttgggagcggcggcagcagac
cccatcctgacagcagaggacaaagaaaagattgatatggtcatcgtggctactgagtca
gggattgaccaaagcaaggcggcagctgtttttgtccatggccttttgggtatccagcct
tttgcccgcagctttgaaattaaggaagcctgctatggagctactgctgcactggactat
gccaagctccatattgaaaaacatccagacagcaaagttttggtgctagctagcgacatt
gccaagtatggcattaacacacctggcgagccaacgcagggagcgggagccatttctatg
ctgattagcagcaatccccgtatcctcgctttcaatgatgataatgtagcccagacacgc
gatgtcatggatttttggcgcccaaattactcgacaacgccttatgtcaacggcctctat
tcaacccagcaatatctggatagcttaaagacaacttgggcggagtaccagaagcgccac
aagctggctctcaaagattttgcggcctactgcttccacctgccttatccaaaactggcc
cttaaaggcctcaataaaatcatggataaaagcctgccccaagagcagcaagaccagctt
agaaagaactttgaagcatctattctctacagccaaaaagttggaaatatctatacaggc
tccctcttcctaggtcttctgtctcttttagaaaactctgacaacctcaaggctggcgat
cggattgctctctttggctatggcagcggagctgtctctgaaatctttagtgccaatttg
gtagagggctatgaaaagcatctatctcaaacacgcctagaggaattagaccagcgtcag
gctctttccatcccgaattacgagcgaatcttttttgaagaagctgagctggatgcggaa
ggcaatgccagcttctctggctatgaggaacaaagctttgctctggcagaaattgcagag
catcaacgtaagtacatcaaagttgagaaatcatcatga

DBGET integrated database retrieval system