KEGG   Streptococcus sanguinis: SSA_0572Help
Entry
SSA_0572          CDS       T00473                                 

Definition
(RefSeq) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SSA_0572
Enzymes [BR:ssa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SSA_0572
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SSA_0572
    1.1.1.-  
     SSA_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C ADH_N_assoc
Motif
Other DBs
NCBI-GeneID: 4807432
NCBI-ProteinID: YP_001034565
UniProt: A3CLG0
Position
567566..568612
Genome map
AA seq 348 aa AA seqDB search
MAKMNAARWYGAKDVRIEEVDVPEVKPHQVKIAVKFTGICGTDLHEYLDGPIFIPTETEH
VYSGQKAPVTLGHEFAGEIVEVGSAVTRVKVGDRVTVEPILAKHNLVGDYNLDPNLNFVG
LAADGGFAKYCVLDGDIVHKVPDSLSYEQAALTEPAAVAVYAVRQSALKTGDTAVVFGLG
PIGLLIIEALRAAGASKIYGVELSPERQAKAEELGAIIVRPEEGEDVVAAIQRLTGGGAD
VSYEVTGVPVVLGQALAAVHKAGECMVVSIWEREASINPNEFAIQEKSLKGIIAYRHIFP
KVLELMEQGYFSADKLVTKKIKLEDIVQEGFIELTQDKAQIKILVSPE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatgaatgctgcgcgttggtatggcgctaaagatgttcgtattgaagaagtg
gatgtaccagaagtcaaaccgcatcaagtcaagattgcggtcaagttcacaggaatatgt
ggaactgacttgcatgaatatctggacggaccgatttttataccgacggaaactgagcat
gtctactctggccagaaagcgcctgtaactttgggacatgagtttgctggggaaattgtt
gaggtcggcagtgctgtgacacgggtcaaagttggcgaccgggtgacagttgagcccatt
ttagctaagcataatcttgtcggtgattataatctggaccctaatctaaactttgtcggt
ttggcggcagacggcggttttgccaaatactgtgttttggacggagacattgttcacaaa
gttccagacagtcttagctatgagcaggcagccttgacagaacctgctgctgtggctgtt
tacgcggtccgtcagtcagctcttaagacgggcgatacagcggttgtcttcggtttggga
ccaatcgggctcttgattattgaggctttgcgggcagccggtgcctctaagatttatgga
gttgaattatctccagaacgccaagccaaggcagaggagcttggggccatcattgtgcga
ccagaagaaggtgaagatgtggtagctgctattcagcgtttaactggtggtggggcagat
gtgtcttatgaagtgactggggtgccggttgtgctgggacaagctttagctgctgtccac
aaggccggagaatgtatggtggtttctatctgggaacgagaagctagcatcaatcctaat
gaatttgccattcaagaaaaatcgcttaagggtattatcgcttaccggcatattttccct
aaggtgctggaactgatggagcagggctatttctctgcagataagctggtgaccaagaag
attaagctagaggatattgtgcaagaaggctttattgagctgactcaggacaaggctcag
atcaagattttagtatcaccagaataa

DBGET integrated database retrieval system