KEGG   Streptococcus sanguinis: SSA_0589Help
Entry
SSA_0589          CDS       T00473                                 

Gene name
dapE
Definition
(RefSeq) acetylornithine deacetylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00300  Lysine biosynthesis
ssa01100  Metabolic pathways
ssa01120  Microbial metabolism in diverse environments
ssa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SSA_0589 (dapE)
Enzymes [BR:ssa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SSA_0589 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 BMC HA
Motif
Other DBs
NCBI-GeneID: 4807437
NCBI-ProteinID: YP_001034582
UniProt: A3CLH7
Position
580885..582267
Genome map
AA seq 460 aa AA seqDB search
MPFSTETEQIKKFENDEVAQHYFEVLRTLISKKSIFAQQVGLQEVANYLGEIFTAAGAKV
MIDDSYTAPFVLAEFLSSNPAAKTIIFYNHYDTVPADDDQPWTNDPFTLSVHYGVMYGRG
VDDDKGHITARLTAVRKYIREHGDLPVNIIFMMEGAEESASTDLDKYLAKHRKRLRGSDL
LVWEQGSRNNLGQLEISGGNKGIVTFDMTVKSADVDIHSSFGGVINSASWYLLNALSSLR
SPDGRILVEGIHEQVQEPNEREIALIEQYALRTPEELSQVYGLKLPVLLDERKEFLRRFY
FEPSLNIEGFGSGYQGQGVKTILPSDAQAKMEVRLVPGLEPEDVLDKIRRQLDKNGYPAV
ELTYTLGEMSYRSDMNAPSILNLIELAKDYYQEGISVLPTSAGTGPMHTVYEALEVPMAA
FGLGNANSRDHGGDENVKIADYYTHIELIQELIGSYRQAD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcctttctcaactgagactgaacaaatcaagaaatttgaaaacgacgaggttgcccag
cactattttgaagtgctgcggaccttgatctctaaaaaatcaatctttgcccagcaggtt
ggcctgcaggaagtagccaactatttgggagagatttttacagctgcaggtgccaaggtc
atgattgacgatagctatactgctccatttgttttggcggagtttctttcttcaaatcct
gctgctaagaccattattttctacaaccactacgatacagtgccagcagatgacgaccag
ccttggaccaatgatccctttacactgtcggttcattacggagttatgtatgggcgagga
gtggatgatgacaaggggcacattaccgctcgtttgacggccgttcgcaagtatattcga
gagcacggtgatttgccggtcaatatcatttttatgatggaaggggcagaagagtctgct
tcgacagacttggataaatatttggccaagcatcgcaaacgcctgcgaggatcagatttg
ctggtctgggagcaaggcagccgcaacaatctaggacagctggaaatctcaggcggtaat
aagggaattgttacctttgatatgacggtcaaaagtgcagatgtagacattcattctagc
ttcggcggtgttatcaattccgcttcttggtatttgctcaatgctctatccagcttgcgc
agtccagacggtcgcatcttagttgaaggcattcatgagcaggttcaagagccaaatgaa
cgggagattgctctgattgagcaatatgccctgcgaactcctgaagagttgagtcaagtc
tatggcttgaaattaccggttttgttggacgaacggaaggaatttctccgtcgcttttac
tttgaaccttcgctgaatattgaaggtttcggatcaggttatcaaggccaaggggttaaa
accattttgccttcagatgctcaggctaagatggaagttcgtctggtgcctggtctggag
ccagaggatgtgttagacaagattcgtcgacagctggataaaaatggatatccggcggtt
gaactgacctataccttgggagagatgagctatcgcagcgacatgaacgcaccatccatt
cttaatcttatcgagctggctaaagattattaccaagagggcatctctgttctgccgact
tcagctggaactggtccgatgcacacggtctatgaggccttggaggttcctatggcagct
ttcggacttggcaatgccaacagccgggaccatggcggagatgagaatgtgaaaattgct
gactactacacgcacattgagctcattcaagagctgattggcagttatcgtcaagctgac
tag

DBGET integrated database retrieval system