KEGG   Streptococcus sanguinis: SSA_0638Help
Entry
SSA_0638          CDS       T00473                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00260  Glycine, serine and threonine metabolism
ssa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01130  Biosynthesis of antibiotics
ssa01230  Biosynthesis of amino acids
Module
ssa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSA_0638 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SSA_0638 (trpA)
Enzymes [BR:ssa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SSA_0638 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-GeneID: 4806759
NCBI-ProteinID: YP_001034627
UniProt: A3CLM2
Position
627075..627854
Genome map
AA seq 259 aa AA seqDB search
MTKTLTQHLETIKREGKGIFLPYIMAGDHEKGLAGLPETIAFLENLGVSAIEIGLPFSDP
VADGPVIEEAGLRSLGHHTSAKSLIASLQKLDTQLPLIIMTYFNPIFQYGLKDFIKDLAR
TPVKGLIIPDLPYEHRDFILPLLEDSDIALVPLVSLTTGLERQQELIKEAEGFIYAVAIN
GVTGKSGSYRNDLDQHLSKLHDIAEIPVLTGFGVSTLEDVDRFNQVSDGVIVGSKIVKAL
HEKDASIAAFIQEAAAYKK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacactcactcagcatttagaaaccatcaaaagagaaggcaagggaattttc
cttccttatattatggctggtgatcacgagaaaggtttagccggattaccagaaactatc
gcatttttggaaaacttgggtgtgtcagccattgaaatcggcctgccattttcagaccct
gttgcagatgggccggttattgaagaagccggtctgagaagtctgggtcaccatacttcg
gccaagtctttaatcgcaagcttgcagaagttggacactcagctgcctctcatcatcatg
acctacttcaatcctatcttccagtacggtctcaaagattttatcaaggatttggctagg
acgccggttaagggattgattattccggatctgccctacgagcatagggactttatcctg
cctctgctggaagattcagatatcgctctagttcctttagtgagccttacgactggacta
gaacgtcagcaggagctaattaaggaggcagaaggttttatctacgctgtagccatcaac
ggtgtaacgggtaagagcggaagctaccgcaatgatttggaccagcatttgagcaagctc
catgatattgctgagattccagtgctgacaggttttggcgtttcaactttagaggatgtt
gatcgcttcaatcaagtctcagacggagtcattgtcggatctaagattgtcaaagctctt
catgaaaaggacgccagtatagcggcctttatccaagaagcagcagcttataagaaataa

DBGET integrated database retrieval system