KEGG   Streptococcus sanguinis: SSA_0676Help
Entry
SSA_0676          CDS       T00473                                 

Gene name
ispA
Definition
(RefSeq) farnesyl diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
ssa  Streptococcus sanguinis
Pathway
ssa00900  Terpenoid backbone biosynthesis
ssa01100  Metabolic pathways
ssa01110  Biosynthesis of secondary metabolites
ssa01130  Biosynthesis of antibiotics
Module
ssa_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ssa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSA_0676 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ssa01006]
    SSA_0676 (ispA)
Enzymes [BR:ssa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SSA_0676 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SSA_0676 (ispA)
    2.5.1.29  geranylgeranyl diphosphate synthase
     SSA_0676 (ispA)
Prenyltransferases [BR:ssa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SSA_0676 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt HTH_30
Motif
Other DBs
NCBI-GeneID: 4806887
NCBI-ProteinID: YP_001034664
UniProt: A3CLQ9
Position
658738..659613
Genome map
AA seq 291 aa AA seqDB search
MTRNEKLEKIGLTIEDFYKSQQVSSDLAEVILYSVQAGGKRIRPLLLLELIQAFGLELAE
AHYQVAAALEMIHTGSLIHDDLPAMDDDDYRRGRLTSHKKFGEDMAILAGDSLFLDPYGL
LARAELPSQVKVDLISELSLAAGSFGMVAGQVLDMQGEGQAISLEDLKIIHANKTGKLLT
YPFVAAGLIVQAQQSVQDKLRRIGELLGLAFQVRDDILDVTASFEELGKTPQKDLAAAKS
TYPAFLGLDGAKNFFNQTLDEAVDILTDLEEKTEFSGGEIQKIIESLRLNG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaacgagaaactggaaaaaatcggtctgacgattgaagatttttataagtct
cagcaagtgtcgtcggatttagcagaagttattttgtattcggtgcaggcaggcggcaag
cggattcgtcccctattgctattggagttgattcaagcttttggtcttgagctggctgag
gcccactatcaggtcgcggcggctcttgagatgattcatactggcagccttatccatgat
gacttgccggctatggatgatgacgactatcgtcgaggtcgcttgactagccataagaag
tttggagaggatatggctattttggcgggtgattctctctttttggacccctatggacta
ttggcaagggccgagttgcctagtcaggtcaaggtggacttgatttctgagttgtctctg
gcagcggggagcttcggtatggtcgcaggacaagttctggatatgcaaggcgaaggccaa
gcaattagtttagaagatttaaaaatcatccatgccaataagactggaaaacttctgacc
tatccttttgtcgcagctggtttgattgttcaggcccagcagtctgttcaagacaagctt
cgtcggattggagagctcttgggcttggcctttcaagtgcgggatgatattttggatgtg
acagccagctttgaagagctgggtaaaaccccgcagaaagatttagctgcggccaagtcg
acttatccagcctttctgggactggacggagctaagaactttttcaatcagacccttgat
gaagctgtggacattctgacagacttggaagagaagacagagttttcaggcggagaaatt
caaaagataatagaaagtttgagattgaatggctaa

DBGET integrated database retrieval system