KEGG   Spiroplasma sabaudiense: SSABA_v1c00310Help
Entry
SSABA_v1c00310    CDS       T03048                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ssab  Spiroplasma sabaudiense
Pathway
ssab00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ssab00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSABA_v1c00310 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssab01007]
    SSABA_v1c00310 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssab03016]
    SSABA_v1c00310 (cysS)
Enzymes [BR:ssab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     SSABA_v1c00310 (cysS)
Amino acid related enzymes [BR:ssab01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SSABA_v1c00310 (cysS)
Transfer RNA biogenesis [BR:ssab03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SSABA_v1c00310 (cysS)
 Prokaryotic Type
    SSABA_v1c00310 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 DALR_2 tRNA-synt_1f tRNA-synt_1d DUF3038 tRNA-synt_1c Peptidase_C3
Motif
Other DBs
NCBI-ProteinID: AHI53443
UniProt: W6A8F3
Position
33821..35152
Genome map
AA seq 443 aa AA seqDB search
MKLSNSLHENNLTSFDNDRVKIYCCGPTVYDNIHIGNARPLVLGDVLVRFFEFIGIKVDY
LQNITDIDDKIIAKANDLKISETQVAEKYINDYLEDLSNLNIKKPNKIIPISTKMDVIID
FINKLITKEVAYESKGDVYFDINSTNSYGELSNKRIEELISGSRVEVNPNKRNASDFALW
KKTKNGKNWVSNWSSGRPGWHTECVALIDNYFQSQVDIHIGGIDLKFPHHENERIQYLAA
TKKELSKIWLHNGHVSFNSQKMSKSLGNTLMVKDFIKDHGANVLRYLLLTTNYRQPINLT
DDLINQSRIAIQKISALFKKISLKIALNEVTKNNDRPVDEDFNLKNYISQFKDLMQDDLN
TPRVITLIEQMIKDINKQIDQKKLNNLLDELLEILVVLGFNFEFPKYDQPTLQLIREWDG
YVKSKNFTKADELREVLIKKDVL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttcaaactctctacacgaaaacaatttaacttcttttgataatgatagggta
aaaatatattgctgcgggccaactgtttatgataacattcacattggtaatgcacgaccc
ctggttttaggcgatgttcttgttcgtttttttgagttcattggaatcaaagtcgattat
ttacaaaatattacagatattgacgataaaataattgcaaaagctaatgatttaaaaatt
tcagagacccaagtagctgaaaaatatattaatgactaccttgaggatttgagcaatcta
aacattaaaaagcccaataaaataatcccaataagcacaaaaatggacgtcataatagat
tttattaataaattgattaccaaagaagttgcatatgaatctaaaggtgacgtgtatttt
gacataaatagcacgaatagttatggggagctatcaaacaaacgaattgaagaattaatt
tctggttctagggttgaggttaaccctaataaaagaaacgcaagtgattttgctctttga
aaaaaaacaaaaaatggtaaaaattgagtttctaattgaagttcgggtcgcccgggttgg
cacacagagtgtgtagcattaattgacaactattttcaatcacaagttgatattcatatt
ggaggaattgatttaaaatttccacatcatgaaaacgaaagaatccaatatttagcagca
accaaaaaggaactatctaaaatttgattgcacaatggccacgttagttttaattcacaa
aagatgtcaaaatctttaggaaatacattaatggttaaggattttataaaagatcatggg
gctaatgttttgagatacttgctcttaacaacaaattaccgccaaccaataaatttaacc
gatgatctaattaatcaatcaagaattgcaattcaaaaaatttcagcactatttaaaaaa
ataagtttgaaaatcgctttaaatgaagtaacaaagaacaatgaccgaccagtagatgaa
gattttaatttaaaaaattatatttcacagtttaaagatttaatgcaagacgaccttaac
acccctcgagttattactttaattgagcaaatgataaaagatattaataaacaaattgat
caaaaaaagctcaataacttgttagatgagctactagaaattcttgtggttttaggattc
aattttgaatttccaaaatatgatcaacccacattgcaactaataagagaatgagatggt
tatgtaaaaagcaaaaatttcaccaaagccgatgagctaagagaagttttaattaagaaa
gatgttttatag

DBGET integrated database retrieval system