KEGG   Spiroplasma sabaudiense: SSABA_v1c08340Help
Entry
SSABA_v1c08340    CDS       T03048                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ssab  Spiroplasma sabaudiense
Pathway
ssab00450  Selenocompound metabolism
ssab00970  Aminoacyl-tRNA biosynthesis
ssab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SSABA_v1c08340 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSABA_v1c08340 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssab01007]
    SSABA_v1c08340 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssab03016]
    SSABA_v1c08340 (metS)
Enzymes [BR:ssab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SSABA_v1c08340 (metS)
Amino acid related enzymes [BR:ssab01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SSABA_v1c08340 (metS)
Transfer RNA biogenesis [BR:ssab03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SSABA_v1c08340 (metS)
 Prokaryotic type
   Other AARSs
    SSABA_v1c08340 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AHI54233
UniProt: W6AAQ3
Position
complement(938216..939736)
Genome map
AA seq 506 aa AA seqDB search
MKKTFYVTTPIYYASGDLHIGHTYTTVLADIMNRYKKLMGYETFFLTGSDEHGQKIATKA
LAENLSPKNYVDKIVEKFKNLWNLLDVDYDKFIRTTDDYHKKAVQEIFSKLVEKDLIYKG
SYKGLYCVSCEEFLTSEQINEEGLCKVSQTKPEILAEETYFLRVSQFSDFLTKLFDTNFL
TPESRKNEMLKNFIEPGLEDLSVTRISLEWGIPTNEDPKHVIYVWIDALSNYITALGYGQ
SENSLLKKFWNSKTEIVQYVGKEITRFHSIYWPVILEGLGLPMPTKLISHGWILAKDTKM
SKSLGNVIDPIAVINGFSSDALRFYIAKELPTERDGNFTEELFIESYNTNLANNIGNLIS
RTNNMIVKYFDGNILEEIDLANHQITNLKNQMIANYIKEMNDYQIHKAVDIVMRFSQELN
KFIEDEKPWALEKSGDTKNLAVVLKVLQESIAVIIHLLSPILTKSYSLMLNQIGYNKPLL
NIYELESGKLVFEKINDRKIIFERIN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagactttttatgtaacaaccccaatttattacgcaagtggggatttacatatt
ggccacacctacaccacggtgttagctgatattatgaatcgctataaaaaacttatgggt
tatgaaactttctttttaacaggatcagatgaacatggtcaaaaaattgcaacaaaagca
ttggctgaaaatctttctccaaaaaattatgtagacaagattgttgaaaagtttaaaaac
ttatgaaatcttcttgatgttgactatgataagtttattagaacaacagatgattaccac
aaaaaggcggtccaagaaattttttcaaaacttgttgaaaaagatttaatttacaaggga
agttacaagggcctttattgtgtaagttgtgaagaatttttaacctctgagcaaatcaac
gaagaaggtttgtgtaaagtttcgcaaaccaaaccagaaattttagctgaagaaacttat
tttttaagggtttctcaattttctgattttttaactaagttatttgacactaatttttta
accccagagtctagaaaaaatgaaatgctaaaaaattttattgagccaggtcttgaagat
ctttctgttacaagaatttctttggagtgaggaattccaacaaacgaagacccaaaacat
gtaatttatgtttgaattgatgctttatccaattatataactgctttgggctatgggcaa
agcgaaaatagtttactaaaaaaattttgaaattcaaaaacagaaattgttcaatatgtg
ggaaaagaaataactagatttcactcgatttattgaccagtaattttagaaggattaggt
ttgccaatgcccacaaagctaatttctcatggatgaattttggcaaaagatacaaaaatg
tcaaaatctttgggaaatgttattgatccaattgctgttattaatggtttttcaagtgat
gcacttaggttttatattgcaaaagaattaccaactgaacgcgatggtaatttcacagaa
gaattgtttattgaatcttataatactaacttggcaaacaacattggcaatctaatttct
agaactaacaacatgattgtaaaatattttgatggaaatattttagaagaaatcgactta
gcaaatcatcaaattacaaatttgaaaaatcaaatgattgcaaattatattaaagaaatg
aatgattatcaaattcacaaagccgttgatattgttatgaggttttctcaagaattgaac
aagttcattgaagatgaaaaaccatgagcacttgaaaaatcaggagacaccaaaaatcta
gcagtagttttaaaagtgttgcaagaaagcattgcagtgatcattcacttgctatcacca
attcttactaaaagttactcattaatgttaaatcaaattggttacaataagcctctgcta
aatatttatgaattagaaagtggcaaattggtttttgaaaaaattaacgaccgaaaaata
atttttgaaagaatcaattaa

DBGET integrated database retrieval system