KEGG   Streptococcus salivarius HSISS4: HSISS4_01759Help
Entry
HSISS4_01759      CDS       T04634                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ssah  Streptococcus salivarius HSISS4
Pathway
ssah00430  Taurine and hypotaurine metabolism
ssah00620  Pyruvate metabolism
ssah00640  Propanoate metabolism
ssah00680  Methane metabolism
ssah01100  Metabolic pathways
ssah01120  Microbial metabolism in diverse environments
ssah01200  Carbon metabolism
Module
ssah_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ssah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HSISS4_01759 (ackA)
   00640 Propanoate metabolism
    HSISS4_01759 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    HSISS4_01759 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HSISS4_01759 (ackA)
Enzymes [BR:ssah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     HSISS4_01759 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ALR80771
UniProt: A0A0A1DZR6
Position
complement(1959941..1961134)
Genome map
AA seq 397 aa AA seqDB search
MTKTIAINAGSSSLKWQLYEMPDEVVLAKGLIERIGLKDSVSTVKFDDRSESQTLDIADH
VQAVKILLDDLIRFDIIKSYDEITGVGHRVVAGGEYFKESSLVDEDALAKIEELSALAPL
HNPGAASGIRAFKELLPDITSVAVFDTAFHTSMPEVAYRYPVPNRYYTDYQVRKYGAHGT
SHQYVSQEAAKLLGKPIEETKIITAHVGNGVSITAVDGGKSVDTSMGLTPLGGVMMGTRT
GDLDPAIIPFVIDREPEMADAERIRHVFNKESGLLGISEKSSDMRDIIAGKNAGDEKCAL
AYDLYVDRLRKYIAQYFGVLNGADAIVFTAGIGENSAEVRASVLDGLTWFGIEVDPEKNV
FGHVGDITTAESAVKVFVIPTDEELVIARDVERLKTK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacaatagcaattaatgcaggaagctcaagcttgaaatggcaactatatgag
atgccagatgaagttgttcttgctaagggtttgattgaacgtatcggcttgaaagattct
gtttccacagtaaaatttgatgaccgttcagaatcgcaaactctagatattgctgaccat
gttcaggcagtaaaaatcttgcttgatgatttgattcgttttgatattatcaagagctat
gatgaaattacaggtgttggtcaccgtgtggttgctggtggagaatatttcaaagaatca
agcttggtggatgaagatgccttggctaagattgaagaattgtcagctttagcaccttta
cacaatccaggtgcagcttcagggattcgtgcctttaaggagctcctcccagatattaca
agtgttgctgtttttgatacagccttccatacatctatgccggaagtggcctaccgttat
ccagtgcctaatcgttactatacagactaccaagtccgtaagtatggagcacacggaact
agccaccaatatgtttctcaagaagcagctaagttgttaggtaagccaattgaagaaact
aagattatcacagcccatgtgggaaatggtgtttctattactgccgttgatggtggtaaa
tcagtagacacgtcaatggggttgacaccacttggtggcgttatgatgggaacacgtact
ggggatcttgaccctgcgattattccatttgttattgaccgtgaacctgagatggcagat
gctgagcgtatccgtcacgtctttaataaggaatcaggccttcttggcatttctgaaaaa
tcaagtgatatgcgtgatatcattgctggtaagaatgctggtgatgaaaaatgtgccttg
gcttatgatctttatgtggatcgtttgcgtaaatacattgctcaatacttcggtgtgttg
aacggagcggatgctatcgtctttacagcaggtattggtgaaaactctgcagaagttcgt
gcttcagttttggatggtctcacttggtttggtattgaagtggatcctgaaaagaatgtc
tttggacatgtaggcgacattacaacagcagagtcagctgttaaagtatttgttatccca
acagatgaagagttggtgattgcgcgtgatgttgagcgccttaaaactaaataa

DBGET integrated database retrieval system