KEGG   Spiribacter salinus: SPISAL_00035Help
Entry
SPISAL_00035      CDS       T02685                                 

Definition
(GenBank) glycine--tRNA ligase
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
ssal  Spiribacter salinus
Pathway
ssal00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ssal00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPISAL_00035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssal01007]
    SPISAL_00035
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssal03016]
    SPISAL_00035
Enzymes [BR:ssal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     SPISAL_00035
Amino acid related enzymes [BR:ssal01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   SPISAL_00035
Transfer RNA biogenesis [BR:ssal03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPISAL_00035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1 RhaA
Motif
Other DBs
NCBI-ProteinID: AGM40108
UniProt: R4VKC8
Position
complement(7304..9394)
Genome map
AA seq 696 aa AA seqDB search
MSQAAETLLFELGMEELPPGALASLSDALTNNLVAGLEKAGIPHGKATGLGAPRRLAVRI
ADVAVQQPDRPFEKRGPAINVAFDESGAPTQAAEGFARSCGVDVAALAQLETAEGAWLVH
RGVETGQSTAELLPGIIEQALTGLPVPKRMRWGSQSAEFVRPVHWVVLLLGDAVVPATFF
GVDSSRQSRGHRFHHPDPVEIARADDYEARLRAAYVAVEMTERRDMIIEGVRAEGERLGG
HAVMETALIDEVNALVEWPVVLSGSFDADFLRVPPEALVSSMQEHQRYFPVRDADGKLLP
RFITVANIESRDPQRVIAGNERVIRPRLADAAFFWDQDRARPLAERQDGLRAVVFQKSLG
SVQDKAQRVAQLASRFATQMGTTPALGERAAALSKADLLTEMVGEFPDLQGVMGRYYAHE
DGEAEAVADALEEIYRPRQAGDAIAATPLGQLMAVVDRADTLIGIFAIGKAPTGAKDPFA
LRRAAVGLLRTLIEGEHAINLHALFSEAGAAQPPGLNAAEQVPALTAFCLERLRAIYLEA
GFAAELFEAVRSVLDVNDFEPLDFDRRIHACKDFSQLPAAGSLAGANKRIRNILRRAEAL
PEAVVDANRLNDTAERELYEAIEARQGDVQRHIEGGEYSQALAQLAELKAPVDRFFDEVM
VMSDDPARQANRLALLQRLQGLFLAIADVSALPESV
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccgctgaaacgctgctgttcgagctgggtatggaggaactcccgcccggg
gcgctggcctccctcagtgatgcgctgaccaacaacctggtcgccggcctcgaaaaggcc
ggcatcccccatggcaaagccactggcctcggtgcgcctcgacgactggcggtgcgcatt
gccgatgtggccgttcaacaacctgatcgcccattcgaaaaacgcggacccgccatcaac
gtggcgttcgatgaatccggggcacccactcaggccgccgagggctttgcccgcagctgc
ggtgttgacgtcgcagcactggcgcagcttgagacggcggaaggtgcctggctggttcac
cgcggggtggaaaccggccagtccacggccgagctactcccgggcatcatcgagcaggcc
ctgacggggctccctgtgccaaaacgcatgcgctggggcagccagagcgcggaatttgtc
cggcccgtgcactgggtggtgctgctcctgggcgatgcggtggtgccagcgacgttcttc
ggtgtggacagcagccgccagagtcggggtcaccggttccaccaccccgacccggtggaa
attgctcgagctgatgactacgaggcccgtctgcgcgcggcctatgtggccgttgagatg
accgaacgtcgagacatgatcatcgaaggcgtccgcgcagaaggcgagcgcctgggcggg
catgccgtgatggagaccgcgctgattgacgaggtcaatgcgctggtggaatggcccgtg
gtgctttcgggaagcttcgatgcggatttcctccgtgtaccaccggaggcgcttgtctcc
agcatgcaggagcaccaacgctatttccccgtccgcgatgcggacggaaaactgctgccg
cgctttatcacggttgccaacattgaaagccgggatccgcagcgcgtgattgccggcaat
gagcgcgtcattcgaccccggctggccgatgcggcgtttttttgggaccaggaccgggcc
cgacccctcgccgagcgtcaggatggactgcgcgccgtggtctttcagaaatcactcggt
agtgttcaagacaaggcccagcgcgtggcgcagcttgcctcgcgcttcgccacccagatg
gggaccacgccagcgcttggcgagcgggccgccgcactctcgaaagccgacctgcttacc
gaaatggtgggtgagtttccggatctgcagggggtcatgggccggtattacgcacacgag
gatggcgaggccgaggcggtcgccgacgcccttgaggagatctatcggccccgccaggcg
ggtgatgccattgcggcaacgccgcttggccaactcatggccgtggttgaccgagcggat
accctcatcggtattttcgcgatcggcaaggcaccgaccggtgccaaagaccccttcgct
ctgcggcgcgccgcggtggggctacttcgcacgctcatcgagggtgagcatgccatcaac
ctgcacgcgctctttagcgaggcgggggccgcccagccacccgggctaaatgccgccgag
caggtccccgcgctaacggcgttctgcctggagcgtctgcgtgccatttatctggaagca
ggcttcgctgcggagctgtttgaggccgtgcgctccgtactcgatgtcaacgacttcgag
ccactcgactttgatcggcgcatccatgcctgcaaagacttctcccagctccccgccgcc
ggcagcctggcaggggccaataagcgcattcgcaatatcctgcggcgcgctgaggcacta
cccgaggccgtggtcgacgctaaccggctgaacgacacggcggagcgtgagctctatgag
gccatcgaggcacggcaaggcgacgttcagcggcatatcgaaggcggagagtacagccag
gccctggcccagctcgccgagctgaaggcacctgtggatcggttttttgacgaggtcatg
gtcatgagcgacgacccggcgcgccaggccaaccgactggccttgctacagcgcttgcaa
gggctgttcctggcgattgcggacgtctctgcactgcccgagtcggtgtga

DBGET integrated database retrieval system