KEGG   Spiribacter salinus: SPISAL_00865Help
Entry
SPISAL_00865      CDS       T02685                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ssal  Spiribacter salinus
Pathway
ssal00670  One carbon pool by folate
ssal01100  Metabolic pathways
ssal01120  Microbial metabolism in diverse environments
ssal01200  Carbon metabolism
Module
ssal_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPISAL_00865
Enzymes [BR:ssal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SPISAL_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AGM40272
UniProt: R4VI31
Position
complement(178832..180562)
Genome map
AA seq 576 aa AA seqDB search
MATPTAETMRPAPLPSDLEIARQADLKPISEVAARMGLGPGIVEPYGHHVGKIPLEAIES
LATRPKGKYVVVSAITPTPLGEGKTTTSVGLAQGFHHIGRTATVALRQPSMGPTFGIKGG
AAGGGWSQVVPMERINLHMTGDIHAVSAAHNLLAAMVDNHLYQGNAANLDPYQVAWRRVV
DINDRGLRQIITGIGGKANGLPRETGFDITAASEVMAVLALADSLDDLRRRLGRVVVGWT
PGGEPVTAEDIGCAGAMAVMLKEAMKPNLMQTLENTPVLVHAGPFGNIAHGNSSIVADRI
GIHGGDFLVTEAGFGADMGAERFFNIKCRTSGMTPDAAVLVATVRGLKVHSGRHRVVAGK
PLPESMLTENPEDVAIGAANLRKQIENMRMHGVPVVVAINAFPTDYASEHAVIAEVAESM
GARVETCTHVKDGGAGAADLARAVEEAANEGSQFAPLYPADMPLSDKIECLATKVYGADG
IDCSAQARRQLAAFTDNGYGHLPVCIAKTHLSLSSDPALHGAPTGWRMPVREARLSAGAG
FVYALAGDMRTMPGLGSHPAAESIDLNEMGEIEGLF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctacgccaaccgccgagacgatgcgtcccgcaccgctgccgagtgatctcgagatc
gcccggcaggctgacctcaaacccattagcgaagtagcagcccgcatgggccttgggcca
ggtattgtcgaaccgtatggccaccatgtcggcaaaattcccctggaagccattgagtcg
cttgccacgcggccgaaggggaaatacgtcgtggtctcggccattacgccaacgccgctc
ggcgaaggaaaaaccaccacctcggtgggcctcgctcagggctttcatcatattggccgg
acggcgacggtcgcgctgcgccaaccctccatggggcccacatttggtatcaaaggcggt
gcggcgggtggcggctggagtcaggttgttcccatggagcgcatcaacctgcacatgacc
ggtgatatccacgcggtttcggccgctcataacctgctcgccgccatggtggataaccac
ctctatcagggcaatgccgccaacctggatccctaccaggttgcctggcgccgagtggtc
gatatcaacgaccgggggctacgccagatcatcacgggtattggcggtaaggccaacggc
ctgccacgggagaccggctttgacattaccgccgcctcagaggtgatggccgtactggcg
ctggccgactcgctggacgacctccgccggcgcctcggccgggttgtggtgggctggaca
cccggtggcgaacccgtcacggccgaggatatcggctgcgctggcgccatggccgtgatg
ctcaaggaggccatgaagcccaatctcatgcagacgctcgagaacacgcccgtgctcgta
catgccgggcccttcggcaacattgcccatggcaacagctccatcgtggcagatcgcatc
ggcatccacggcggtgacttcctggtcaccgaggcgggctttggcgcagacatgggcgcc
gagcgctttttcaacatcaaatgccgcacctcgggcatgacgccggatgctgccgtgctg
gtggcgaccgtgcgcgggctcaaggtgcactccggccggcatcgggtggtcgccggcaaa
cctttgccggagagcatgctcaccgagaatcccgaggacgttgccatcggcgcggccaat
ctgcgcaaacagatcgagaacatgcgcatgcacggggtaccggtcgtcgtggcaatcaac
gccttccccacggactacgcaagcgagcacgccgtgatcgccgaagtggccgagtccatg
ggcgcacgtgttgaaacctgcacgcacgtcaaggatggcggtgcaggcgcggccgatctg
gcccgtgccgtggaagaggccgccaacgaaggcagccagtttgcgccgctctacccggcg
gacatgccgctatccgataagatcgaatgcttggcaacgaaggtctatggcgcggatggc
atcgactgctccgcccaggcccgtcgtcaactcgccgcatttaccgacaatggctatggc
catttgccggtatgcatcgcaaagacccatctctcgctgtcctccgacccggcgcttcac
ggtgcgccgaccggctggcggatgccggttcgggaggcacggctctccgctggcgcgggc
tttgtctacgccctggccggtgacatgcgcaccatgcccgggcttggatcgcatccagca
gccgagtcgattgacctcaacgaaatgggtgaaatcgaaggcctcttctga

DBGET integrated database retrieval system