KEGG   Spiribacter salinus: SPISAL_02135Help
Entry
SPISAL_02135      CDS       T02685                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssal  Spiribacter salinus
Pathway
ssal00071  Fatty acid degradation
ssal00280  Valine, leucine and isoleucine degradation
ssal00310  Lysine degradation
ssal00380  Tryptophan metabolism
ssal00620  Pyruvate metabolism
ssal00630  Glyoxylate and dicarboxylate metabolism
ssal00640  Propanoate metabolism
ssal00650  Butanoate metabolism
ssal00900  Terpenoid backbone biosynthesis
ssal01100  Metabolic pathways
ssal01110  Biosynthesis of secondary metabolites
ssal01120  Microbial metabolism in diverse environments
ssal01130  Biosynthesis of antibiotics
ssal01200  Carbon metabolism
ssal01212  Fatty acid metabolism
ssal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPISAL_02135
   00630 Glyoxylate and dicarboxylate metabolism
    SPISAL_02135
   00640 Propanoate metabolism
    SPISAL_02135
   00650 Butanoate metabolism
    SPISAL_02135
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPISAL_02135
   00072 Synthesis and degradation of ketone bodies
    SPISAL_02135
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPISAL_02135
   00310 Lysine degradation
    SPISAL_02135
   00380 Tryptophan metabolism
    SPISAL_02135
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPISAL_02135
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPISAL_02135
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPISAL_02135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssal04147]
    SPISAL_02135
Enzymes [BR:ssal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPISAL_02135
Exosome [BR:ssal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPISAL_02135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGM40524
UniProt: R4V3D7
Position
432592..433770
Genome map
AA seq 392 aa AA seqDB search
MENVVITAAGRSAVGTFGGTLSALTAAEIGSQVIRGVLERASVDPQIIDEVILGQVLTAA
CGMNPARQAALNAGLPVTTPAMTLNKVCGSGLKATHLASQAIRLEDAGVVLAGGQESMSN
APHALPNSRKGQRMGPWTMDDTMIKDGLWDAFNDYHMGVTAENLAEDFGISREEQDAFAA
RSQQLAEAAQKAGRFADEIVPVEIPQRKGDPVVFDTDEFPRHGSTAEGFAKARAAFKKDG
SVTAANASGINDGAAVVLMMSESRAKALGLEPIARIKAYANAGVEPRIMGSGPIPATRRC
LERAGWGVDDLDLIESNEAFAAQALAVSKEIGWDPEKVNVNGGAISIGHPIGASGARILV
TLLHEMQRRDVQRGLATLCIGGGQGVALAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtcgtcattaccgccgctgggcgcagcgctgtggggacttttggcggaacg
ctatccgcattaaccgccgcggaaatcggctctcaggtgattcgtggggtgctggagcgg
gcctccgttgacccccagatcatcgatgaggtgattctcgggcaggtcctgaccgccgca
tgcgggatgaatccagcccgtcaggctgcgttgaacgccggtctaccggtgaccacaccg
gcaatgaccctcaacaaggtctgcgggagtggcctcaaggcaacccatctggccagccag
gcgattcggctggaagacgccggtgttgtcctggccggtggccaggagtccatgagcaac
gctccgcacgcgctgcccaattcccgcaaaggtcagcggatggggccgtggacgatggat
gacaccatgatcaaggatggattgtgggatgcctttaacgactaccacatgggcgtgacg
gccgagaatctggccgaggatttcggcatcagccgcgaggagcaggacgcgtttgcggcg
cgctcccagcagcttgccgaggccgctcagaaggcaggccgtttcgcggacgagatcgtc
ccggtcgagattccccagcgtaagggcgacccggtggtctttgataccgacgagtttccg
cgccacggcagcaccgcggaagggtttgccaaagctcgcgcggcgtttaagaaagacggc
agtgtgaccgcggccaacgcctcaggcattaacgatggggcggccgtggtgctgatgatg
tccgagagtcgcgcgaaggcgctcggccttgagcccatcgcccgcattaaggcctacgcc
aatgcgggcgttgagccgcggatcatggggagcggcccgattcctgccacgcggcgctgc
ctcgagcgtgccgggtggggcgtcgacgacctggatttgatcgaatccaacgaggctttt
gcggctcaggcgctcgccgtgagcaaagagatcggctgggatccagaaaaggtcaatgtg
aacggtggcgcgatctcgatcggtcatccgataggcgcctctggggcgcgcatcctggtg
acattgctccacgaaatgcagcgccgggatgttcagcgcgggctggcgacgctctgcatt
ggcggcggtcagggcgtcgcactggctgttgagcgctaa

DBGET integrated database retrieval system