KEGG   Sphingomonas sanxanigenens: NX02_06335Help
Entry
NX02_06335        CDS       T03929                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00071  Fatty acid degradation
ssan00072  Synthesis and degradation of ketone bodies
ssan00280  Valine, leucine and isoleucine degradation
ssan00310  Lysine degradation
ssan00362  Benzoate degradation
ssan00380  Tryptophan metabolism
ssan00620  Pyruvate metabolism
ssan00630  Glyoxylate and dicarboxylate metabolism
ssan00640  Propanoate metabolism
ssan00650  Butanoate metabolism
ssan00900  Terpenoid backbone biosynthesis
ssan01100  Metabolic pathways
ssan01110  Biosynthesis of secondary metabolites
ssan01120  Microbial metabolism in diverse environments
ssan01130  Biosynthesis of antibiotics
ssan01200  Carbon metabolism
ssan01212  Fatty acid metabolism
ssan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NX02_06335
   00630 Glyoxylate and dicarboxylate metabolism
    NX02_06335
   00640 Propanoate metabolism
    NX02_06335
   00650 Butanoate metabolism
    NX02_06335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NX02_06335
   00072 Synthesis and degradation of ketone bodies
    NX02_06335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NX02_06335
   00310 Lysine degradation
    NX02_06335
   00380 Tryptophan metabolism
    NX02_06335
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NX02_06335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NX02_06335
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NX02_06335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssan04147]
    NX02_06335
Enzymes [BR:ssan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NX02_06335
Exosome [BR:ssan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NX02_06335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHE52997
UniProt: W0A951
Position
1255890..1257065
Genome map
AA seq 391 aa AA seqDB search
MPEAYIVSARRTAGGRRNGRLAGWHPADLGALVLDALVADAGVDPAAIDDVIIGCVSQVG
EQTFAFGRNIVLASNLPDSVPAVTIDRQCGSSQQAVHFAAQAVMSGLQDIVIAGGVESMS
RVPMGSPITLAQAGGIGFNPFSASIQKRYGVEMFSQFHGAQAIADKYGFTREDHDRFALD
SHRKAAAAIEAGAFDKEIVPVPIVTAGGEQAVHDRDEGVRAGATLESIGSVKLLSEGGTL
SAATASQICDGASGVLVASEAAVKAHGLTPIARIVNLAVTAGDPVIMLEEPIPATRRVLE
RAGLSMRDIDLFEVNEAFASIPMAWMKALDSDPAKLNVNGGAIALGHPLGATGTKLMATL
IHALKARGQRYGLQTMCEGGGIANASIIEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagcctatatcgtctccgcgcgtcgcaccgctggcggccgccgcaatggccgc
ctcgccggctggcatcccgccgacctcggcgcgctcgtgctggacgcgctggtcgccgac
gcgggcgtcgatcccgctgcgatcgacgacgtgatcataggctgcgtcagtcaggtcggc
gagcagacctttgccttcggccgcaacatcgtgcttgcctccaaccttcccgacagcgtt
ccggcggtgaccatcgatcgccagtgcggttcttcacagcaggcagttcatttcgcggcg
caggcggtgatgtcggggcttcaggacatcgtcatcgccgggggtgtcgaaagcatgagc
cgcgtgccgatggggtctccgatcacgctcgcccaggcgggtggcatcggctttaatccg
ttctcggcatccatccagaagcgttacggcgtagagatgttcagccaattccatggcgcc
caagcgattgccgacaaatacggcttcacgcgcgaagatcatgaccggtttgcgctggac
agtcaccgcaaggcggcagcggcgatcgaggcgggtgcctttgacaaggagatcgtgccc
gtgccgatcgtcacggccgggggcgagcaggcggttcacgaccgtgacgaaggggtgcgt
gccggagccacgctggagtcgatcgggtcggtcaagctgctgagtgaaggtggcacgctc
tctgccgcgacggccagccagatctgtgacggggcgagcggcgtccttgtcgcctcggaa
gcggcggtgaaggcgcatgggctcacgccgatcgcccggatcgtcaaccttgcggtgacg
gccggcgaccccgtgatcatgctggaggagccgatcccggcaacccggcgcgtgttggaa
cgcgccggcctctcgatgagagatatcgacctgttcgaggtcaacgaagccttcgcctca
attccgatggcgtggatgaaggcgctggattcggaccccgcaaagctcaacgtcaacggc
ggcgcgatcgcgctcggccatcccctgggggcaacgggcacgaaactgatggcgacgctt
atccacgccctgaaggcccgcgggcagcgctacggcctgcagacgatgtgcgagggcggc
ggcatcgccaacgcctcgatcatcgaggtgctttga

DBGET integrated database retrieval system