KEGG   Sphingomonas sanxanigenens: NX02_09430Help
Entry
NX02_09430        CDS       T03929                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00020  Citrate cycle (TCA cycle)
ssan00620  Pyruvate metabolism
ssan00650  Butanoate metabolism
ssan01100  Metabolic pathways
ssan01110  Biosynthesis of secondary metabolites
ssan01120  Microbial metabolism in diverse environments
ssan01130  Biosynthesis of antibiotics
ssan01200  Carbon metabolism
Module
ssan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NX02_09430
   00620 Pyruvate metabolism
    NX02_09430
   00650 Butanoate metabolism
    NX02_09430
Enzymes [BR:ssan01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     NX02_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF
Motif
Other DBs
NCBI-ProteinID: AHE53607
UniProt: W0AAV5
Position
complement(1950104..1951573)
Genome map
AA seq 489 aa AA seqDB search
MSAQDAARLIAPGTTVGMSGFTGSGYPKAVPLALAERIEAEHAAGNPFSLRVWTGASTGP
ELDGALARADGIEFRLPYNSDPIAREKINRGEMEYFDMHLSQVAPMAWQGFLGPLDTALV
EISGIRPDGSLIPSSSVGNNKTWLDRASQVILEVNSWQNPALEGMHDIYYGTALPPHRVP
IPLVRPDDRIGETGFRCDPAKIVAIVETDAPDRNLPFKAPDEDALTIAGHLLEFFRHEVA
RSRLPASLLPIQSGVGNIANAVLTGLVDSPFEDMTAYTEVIQDGMLDLLAAGKLRMASAT
AFSLSPEAAAGLNADMERFRDKMVLRPQEISNHPELIRRLGCIAMNGLIEADIYGNVNST
HVMGSRIQNGIGGSGDFARNAYVSIFMTPSLAKRGAISAIVPQVSHVDHINQDVQILVTE
QGLADLRGLSPKQRARLIIEKCAHPRYRPALSDYFERALRSSYGKHSPSLLAEALSWHLR
FVETGTMMA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcaggatgccgcgcggttgatcgcgcccggcaccacggtgggcatgagcggc
ttcacgggttccggctatcccaaggcggtcccgctcgcccttgcggaacggatcgaggcc
gagcatgcggcaggcaaccccttctcgctgcgcgtctggaccggcgcctcgacggggccc
gaactcgacggtgcgctggccagggccgacggcatcgagttccgcctgccctataattcc
gacccgatcgcccgcgaaaagatcaaccgcggcgagatggaatatttcgacatgcatctg
agccaggtcgcgccgatggcatggcagggcttcctgggtccgctggacacggcgttggtg
gagatcagcggtatccggccggacgggtcgctgattccgtcgtcgtcggtcggcaacaac
aagacgtggctggaccgggcgagccaggtcatcctcgaagtgaacagctggcagaacccg
gctctcgaaggcatgcacgacatctattatggcaccgccctgcccccgcaccgcgtgccg
atcccgctcgtgcggccggatgacaggatcggcgagactggattccggtgcgaccccgcc
aaaatcgtcgccatcgtcgaaacggacgcgcccgaccgcaacctgccgttcaaggcgccc
gacgaggatgcgctgaccatagccgggcacctgctggagttcttccgtcatgaggtcgcg
cggagccgattgcctgcgtccctgctgccgatccagtcgggggtgggtaacatcgccaac
gccgtgctgacgggccttgtcgacagcccgttcgaggacatgaccgcctataccgaggtg
atccaggacgggatgctggacctgcttgctgccggcaagctgcgcatggcctccgcgacg
gccttctcgctcagccccgaggcagccgcaggtctcaacgccgacatggagcgttttagg
gacaagatggtgttgcgtccacaggagatcagcaaccatcccgaactgatccgccggctg
ggctgcatcgcgatgaacgggctgatcgaagccgacatctacggcaacgtcaattccact
catgtcatgggctcgcgcatccagaacggcattggcggatcgggcgatttcgcgcgcaac
gcctatgtgtcgatcttcatgacgccctcgctcgccaagcgcggggcgatctcggccatc
gtgccgcaggtgagccatgtcgaccacatcaaccaggatgttcagatactcgtgaccgag
caggggctggccgacctgcgcggtctctcgcccaagcagcgcgcgcgactgatcatcgag
aaatgcgcgcatcctcgctacaggccggcgctgtccgattatttcgagcgggccttgcgg
tcatcctacggcaagcactcgccgtccctgttggctgaagccctgtcatggcacctgcgc
ttcgtggagacgggcacgatgatggcctga

DBGET integrated database retrieval system