KEGG   Sphingomonas sanxanigenens: NX02_18960Help
Entry
NX02_18960        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00621  Dioxin degradation
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Module
ssan_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    NX02_18960
Enzymes [BR:ssan01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     NX02_18960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Chlorophyllase
Motif
Other DBs
NCBI-ProteinID: AHE55456
UniProt: W0AED7
Position
4008349..4009173
Genome map
AA seq 274 aa AA seqDB search
MEIASHFIDVDGVLTHYLEAGEGPPLLLVHGGGAGADSWGNWKDCFAHFAPHFRVIAPDM
IGFGKTDKPSPEAYVYDQPGRNRHLAGFIDAMDLSGVAIVGNSMGGASAIGVALDRPELL
SKIVLMGSAGLPIPPRPSPHLLHNLHYDFTREGMRRVIGGLTAPGFEPGEEMVEYRFQLL
ENDEARAALSAINAETRKGTLNYDEDRLATIAHPVLVVNGKDDGVSILPRAYRFLELLPN
SWGYIVPHCGHWAMIEATDDFCGAVNRFLGVAAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcatcgcatttcatcgacgtcgacggcgtccttacccactatctcgaagcg
ggggagggtccgccgctgctgctcgtccatggcggcggcgcgggcgcggacagctggggc
aactggaaggattgcttcgcgcatttcgcgccgcatttccgcgtgatcgcacccgacatg
atcggcttcggcaagaccgacaagccatcgcccgaggcctatgtctatgaccagccgggg
cgcaaccgccaccttgccggcttcatcgacgcgatggacctttcgggcgtcgcgatcgtc
ggcaattcgatgggcggcgcaagcgcgatcggcgtggcgctggaccggccggaactgctc
tcgaagatcgtgctgatgggcagcgccgggctgccgatcccgcccaggccgtcgccccat
ctgctccacaacctccactatgatttcacgcgcgagggcatgcgcagggtgatcggcggg
ctcaccgcgccgggcttcgaacccggcgaggagatggtcgagtatcgcttccagctgctc
gagaatgacgaggcgcgcgccgcgctctccgcgatcaacgccgagacgcgcaagggcacg
ctcaactatgacgaggatcggctggcgacgatcgcgcacccggtgctggtggtgaacggc
aaggatgatggcgtgtcgatcctgccgcgcgcctatcgcttcctcgaactgctgcccaac
agctggggctatatcgtgccgcattgcgggcattgggcgatgatcgaggccacggacgat
ttctgcggcgcggtcaatcgcttcctcggcgtcgcggcggcatga

DBGET integrated database retrieval system