KEGG   Sphingomonas sanxanigenens: NX02_20860Help
Entry
NX02_20860        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00430  Taurine and hypotaurine metabolism
ssan00620  Pyruvate metabolism
ssan00640  Propanoate metabolism
ssan00680  Methane metabolism
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01200  Carbon metabolism
Module
ssan_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NX02_20860
   00640 Propanoate metabolism
    NX02_20860
  09102 Energy metabolism
   00680 Methane metabolism
    NX02_20860
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NX02_20860
Enzymes [BR:ssan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     NX02_20860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase TruB_C
Motif
Other DBs
NCBI-ProteinID: AHE55813
UniProt: W0AHN2
Position
4415186..4416373
Genome map
AA seq 395 aa AA seqDB search
MRAVVSLNSGSSSIKFALFTLDEEGAPGLSAGGKIEKIGIAPALAIHDASGNIVHTRAWD
DPALTHGDLLAWLFDWAAGHLEGRELIAIGHRVVHGGMDFAHPCRVTPEVLEALEALCPL
APLHQPHNLAAIRAIIRIAPDLPQIACFDTAFHHDRPAIATRFALPRALHDQGIRRYGFH
GLSYDYIARTLAERDPDLAAGRVIAAHLGNGASLCAMAGGRSVDTTMGFTALDGLVMGTR
CGTLDAGVVLHLQRRMGMTAQEVEAMLYNRSGLLGVSGLSSDMRTLSASAAPEAEEAIDL
FAWRAAREAGALAASLGGVDGFVFTAGIGENHSDVRARICRRLGWLGIALDAEANAGHKP
VISLPGSAVTVRIIPTDEERMIALHTLALLSATRA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggtcgtcagcctcaattcgggctcgtcgagcatcaagttcgcgctgttcaca
ttggacgaggagggcgcgcccggactttcggcaggcggcaaaatcgagaagatcggcatc
gcccccgcgctcgccatccacgatgcgagcggcaatatcgtgcacacgcgcgcttgggac
gatcccgccctcacccatggcgacctcctcgcctggctgttcgactgggcggccgggcat
ctcgaggggcgcgagctgatcgcgatcggccaccgcgtcgtccatggcggcatggacttc
gcgcacccctgccgcgtcacgccggaggtgctggaagcgctggaggcgctctgcccgctc
gcgccgttgcaccagccgcacaacctcgcggcgatccgggcgatcatccggatcgcgccc
gatctgccgcagatcgcctgcttcgacaccgccttccaccatgaccggccggcgatcgcg
acgcgcttcgccctgccccgcgcgctgcacgaccagggcatccgccgctacggcttccac
ggcctctcctacgactatatcgcgcgcaccctggccgaacgcgatcccgatctcgccgcc
ggccgggtgatcgccgcgcatctcggcaacggcgcctcgctgtgtgcgatggcgggcggg
cgcagcgtcgatacgacgatgggcttcaccgcgctcgacggtctggtgatgggcacgcgc
tgcggcacgctggatgccggcgtcgtcctccacctccagcgccggatgggcatgaccgcg
caagaggtggaggcgatgctctacaaccgatccggcctgctcggcgtctccggcctctcc
agcgacatgcgcacgctctccgccagcgccgcgcccgaggcggaagaagcgatcgacctc
ttcgcatggcgtgccgcacgcgaggccggggcgctggccgcgtcgttggggggcgtcgac
ggcttcgtcttcaccgcgggcatcggcgagaaccatagcgatgtccgcgcgcgcatctgc
cggcgtctgggctggctgggcatcgcgctcgacgcggaggccaatgcggggcacaagccg
gtgatcagcctgcccggaagcgccgtcacggtgcgaatcatcccaaccgacgaggaacgc
atgatcgccctccacacgctcgcgctgctttcggccaccagggcatga

DBGET integrated database retrieval system