KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_1164
Entry
SSUBM407_1164     CDS       T00935                                 

Symbol
pflD
Name
(GenBank) putative formate acetyltransferase
Organism
ssb  Streptococcus suis BM407 (serotype 2)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: CAZ56022
UniProt: A0A0H3MVM3
Position
complement(1246564..1249008)
AA seq 814 aa
MKTVTEVAGTSIKTEYFGSLTDRMNKYREDVLDKKPYIDAERAVLATKAYQEHREKPNVL
KRAYMLKEILENMTLYIEEESLIAGNQASSNKDAPIFPEYTLEFVLNELDLFEKRDGDVF
YITEETKEQLRSIAPFWEKNNLRSRAGVLLPEEVQVYMETGFFGMEGKMNSGDAHLAVNY
QKVLEQGLRGFEERVRVAKANLDLTDPASIDKYHFYDSIFIIIDAVKAYADRFVALATEL
AEKAPTAQRRQELLEIARICAKVPYEPAETFAEAVQSVWFIQCILQIESNGHSLSYGRFD
QYMYPYVKADLEAGRETEDSIVERLTNLWIKTITINKVRSQSHTFSSAGSPLYQNVTIGG
QTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDARFMNECIEVMKLGFGMPAFN
NDEIIIPSFIEKGVLEEDAYDYSAIGCVETAVPGKWGYRCTGMSYMNFPKVLLITMNDGI
DPASGKRFAPAFGHFKDMKSFEVLETAWEKTLRHLTRMSVIVENAIDIALEREVPDILCS
ALTDDCIGRGKHLKEGGAIYDYISGLQVGIANLSDSLAAIKKLVFEEGRLTPEELWHALE
TDYAGERGKEIQEMLIEDAPKYGNDDDYADQLVTAAYDIYINEIAKYPNTRFGRGPIGGI
RYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCSPSHNMDKNGPTSVLKSVAKLPTHE
IVGGVLLNQKVNPQTLAKEEDKQKLIALLRTFFNRLHGYHIQYNVVSRETLIDAQLHPEK
HRDLIVRVAGYSAFFNVLSRATQDDIIGRTEHTL
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgaaaacagtgactgaagtagctggcactagcattaaaactgagtattttggaagtctg
actgatcggatgaacaaatacagagaagatgtccttgataagaagccctatattgacgcg
gaacgggctgttttagcaacaaaagcctatcaagaacatagagagaagcccaatgtatta
aaaagggcctatatgctcaaggaaatattggagaacatgacgctttatattgaagaagaa
agtctgattgcaggtaaccaagcttcttcaaataaagatgctcccatcttcccagaatat
accttggagtttgtattgaatgaattggatttattcgaaaaacgggatggggatgtcttc
tatattaccgaggaaactaaagagcagttgcgcagcatcgctccattctgggaaaagaat
aatcttcgttcacgtgcaggtgtcttgcttccagaagaagttcaagtttatatggaaact
ggcttctttggtatggaaggtaagatgaactctggcgatgcccacttggctgtcaattac
caaaaggtattggaacaaggtttgcgtggttttgaggagcgagttcgtgtagcaaaggct
aatctcgatttgacggatcctgcaagtattgataaatatcatttctatgactcaatcttt
atcatcattgatgcggtgaaagcatacgcagatcgttttgtcgccttggctactgaattg
gcagagaaagcaccaacagctcaacgccgtcaagaactactggagattgcacggatttgt
gcgaaggtgccgtatgaacctgctgaaacatttgcagaggcagtgcaatcggtctggttt
atccagtgtatcttgcaaatcgagtccaatggacattctctatcctatggacgtttcgac
caatacatgtatccgtatgtgaaagctgatttagaagcaggacgtgaaacggaagacagc
atcgtcgaacgcttaactaacttgtggattaagaccattactatcaacaaggttcgtagt
caatcacataccttctcatctgctggtagtccactataccaaaatgtaaccattggtgga
caaacacgtgataagaaggatgctgtcaatccactttcttacttagtattgaaatctgtt
gcccaaacacacctgccacagccaaacttgactgttcgctatcatgcaggcctagatgct
cgcttcatgaatgaatgtattgaagtcatgaaacttggttttggtatgcctgcctttaac
aacgatgaaattatcattccctcctttatcgagaaaggtgtcttggaagaagatgcctat
gactacagtgcgattggctgtgtagaaacggctgttcctggtaaatggggataccgttgt
acaggtatgagctatatgaacttcccgaaagttttattgattaccatgaatgatggtatc
gatcctgcatcaggcaaacggtttgcaccagcctttggtcacttcaaagatatgaaatcc
tttgaagtgcttgaaacggcatgggaaaagacacttcgtcatctaacacggatgagtgtc
atcgttgaaaatgcaattgacattgctttagaaagagaagtaccagacattctctgctca
gctctgacagatgactgtatcggtcgtggtaagcacctgaaagaaggtggagcgatttac
gattacatttctggtctgcaggttggcattgccaatttatctgattctctagcagcaatc
aaaaaattagtctttgaagaaggacgattgactccagaagaattatggcatgctttggaa
acagactatgctggggagcgtggtaaagaaatccaggaaatgttgattgaagatgcacca
aaatatggtaacgatgatgattatgcagaccaattggtaacagcagcatatgatatttat
atcaatgagattgccaaatatccaaacactcgctttggtcgtggtccgattggtggtatc
cgctattcaggtacatcatccatttcagccaacgttggacaggggcgtggtactttggca
actccagacggtcgcaatgcaggaacaccgttggcagaaggttgttctccatcacataat
atggataaaaatggaccgacatccgttttgaaatcagttgccaaattaccaacacatgaa
attgttggaggcgttctgctcaatcagaaggtcaatccacaaacacttgccaaagaagaa
gacaaacaaaaattaattgccctcttgcggacattctttaaccgcttgcatggctatcat
attcagtacaatgttgtctctcgagaaaccttgattgatgcacaactacatcctgaaaaa
caccgtgatttgattgtccgtgtagcaggttattcagcattcttcaatgtattgtcgaga
gcaacacaagacgacatcattggtcgtacagaacatacattgtaa

DBGET integrated database retrieval system